KEGG   Hippocampus comes (tiger tail seahorse): 109523695
Entry
109523695         CDS       T04969                                 

Gene name
apaf1
Definition
(RefSeq) apoptotic protease-activating factor 1 isoform X1
  KO
K02084  apoptotic protease-activating factor
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
hcq04210  Apoptosis
hcq05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109523695 (apaf1)
   04115 p53 signaling pathway
    109523695 (apaf1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109523695 (apaf1)
SSDB
Motif
Pfam: WD40 APAF1_C NB-ARC ANAPC4_WD40 CARD Ge1_WD40 WD40_like eIF2A CARD_2 AAA_16 Utp8
Other DBs
NCBI-GeneID: 109523695
NCBI-ProteinID: XP_019738589
LinkDB
Position
Unknown
AA seq 1255 aa
MMLDEGARSSLLRFRQNLEQDIKPAYLMDHMISDGVLSGEEEERISEWPSRKEQAASLLE
LLLKKDNSAFISFYNALVKEAYYDLANLLHAALPGDTPNSSNSTSDVQIVLSAGGVPQRP
VVFVSRPELINKIREKLYHLRQDTGWVTVFGMAGSGKSVLVAEAVRDQRLIEECFPGGIH
WLSIGQLDKANLLVKIQALCFRLEQSLDSQSLQRPPTSLDEAKERLRFLVLRRYPRSLLI
LDDIWDSTVLKSFDIHCRILLSTRNRSLTDSVSGAKHEVEVESGLDDNKALEIIALYTRN
ALECLPEEARSIVRECKGSPLVVSLIGALLKEKPDRWSYYLRQLQQKQFKRIRKSSSYDY
DALDQAMAASIEVLPDEHRELYRDLAVLEPDIKIPAKVLSILWDLEPEEVEDILEEFVNK
SLLFVDSHRKPALYYLHDLQLDFLVEQNRAQLENLHTKVVRQYQQHYSETPPTSGDEECL
YWIRFLTYHMAKANLSQELYSLMFSLDWITHKAQILGPAHLLNDFVEYGSILDKKNSNVR
SHFQEFLSLNGHQLEQRPFPDVVQLALSQPQASEVYRQALQRAQERARSGKLYFDWLNKS
SVESLSRLVIHPHQGSVYAACFSQDGTKIASCGASKTLKVFRSTSGEKLTEIQAHDDEVL
CCAFSPDDRLLATCSSDRKVKVWNAERGMLLRVFEVEHEEQVNHCQFTNTRRRLLLATCS
NDSFLNVKLWNLNKPTSQNTMFGHFEPVNHCCFSPDDAYLSTSSNDGTVKIFEVSSANEW
KTINVREWCAEAGEEVPVKCSTWTGDGKRVVCAVRSAVLVMDVETSQMLLEIRTGRLSMV
QYCDACPTSNLLAIAFSNYAVELWDLADNKKMADCSGHLSWVQRVQFSPDGSQLLSCADD
QTVRLWQTDKVHTTSAVRLKRDSDAFFDSGEDGQFFVSAADNCNRLQVRAGRAGSLLFQS
EEMASRIRCTCFCSKPLAVAFGTEDGTVEILAIPSGKVLATLLGHTKTVLHCQFLHAGQT
LITSSEDTTINVWKWQSHECLVLRGHKEQVRCFSLLSPAETRMLSCSFDGTVKVWELESG
EELQHIEAHRGAILSCHVSPDGRFFATTSADKIAKVWWHSESWQCVHVLCGHQDCVRSCR
FSCDGRRLATGDDGGEIRLWSVTEGTLLKICSRDGKDGLDSLHGGWVTDLHFSPDDSLLV
STGGYVKWWDVDKGEALQTFYPTGSALKKVHVSPDFSTFVTIDNIGILYVLQRVV
NT seq 3768 nt   +upstreamnt  +downstreamnt
atgatgctggacgaaggcgcccggagcagcctgctacgctttcgccagaacctggagcag
gatatcaagcctgcctacctgatggatcacatgatcagtgacggcgtgctgagcggcgag
gaggaagagaggatcagtgaatggcctagcaggaaagagcaggcggcgtcgctactggaa
ctgctgctcaagaaggacaacagcgcttttatctcattttataatgctctcgtcaaggag
gcgtactacgacttggctaatttgcttcacgccgcccttcctggtgacacaccaaacagc
tctaacagcacatctgatgtccaaatagttctgagcgcaggcggggtccctcagaggcct
gtggtttttgtcagccgacccgaactgatcaacaagatccgggagaagctctaccatctc
cggcaggacacgggatgggtcactgtgttcgggatggccggctcgggaaaatctgtgctg
gtggcggaagctgtacgagaccagagactgattgaagagtgcttcccaggaggtatccac
tggttgtccatcggccagctggacaaagccaacctgctggtgaagatccaagcgctgtgc
ttccgcctggagcagagcctggactcccaatccctccaacggcctcccacctccttggac
gaggccaaggagcgtctgcgcttcctggtgttgcgcagataccccagatctctgctgatt
ctggatgacatctgggacagcacggtgctgaaatcattcgatatccactgccgcatcctt
ctgagcaccaggaatagaagcctcactgactcagttagtggtgccaaacatgaagtggag
gttgagagtggtttggatgacaacaaggcactggagattattgccctgtataccagaaac
gcactcgaatgtttgcctgaggaggctcggagcattgtgagagaatgtaaagggtcccct
ctggtggtctccctgattggcgcgctactcaaagagaagcccgaccgttggagctactac
ctgcggcagctgcagcagaagcagttcaagcgcatccgtaaatcgtcgtcatacgactac
gacgcgctggaccaggcaatggcggccagcatcgaagtgctgcccgacgagcaccgggag
ctctacagggacctcgccgtgctggagcccgacatcaaaattcccgccaaggtgttgtcc
attctgtgggatctcgagcccgaggaggtggaggacatcctggaggagtttgtcaacaag
tctcttctgtttgtggacagtcaccgcaaacctgcactgtactacctccacgacctccaa
ctggacttcttggtcgagcagaatcgcgcccaactcgagaaccttcacaccaaggtggtg
cgtcagtaccagcagcactacagtgaaaccccgcccacatctggagacgaagaatgcctc
tactggatccggttcttaacctaccacatggccaaagccaacctctcccaggagctctac
tcgctcatgttctcactggactggatcacccacaaggcccagatactgggtccggctcat
cttttaaatgactttgtggagtatggatccattctggataaaaagaacagcaacgtgcgc
agtcacttccaggagtttttgtccctcaacggccaccagctggagcagcggccgtttccc
gacgtggtccagctggctctgtcgcagcctcaggcttcggaagtctacaggcaggctctg
cagcgggcgcaggagcgggccagaagcgggaaactctattttgactggctaaataagagc
agcgtggagagtctttcccggctggtgatccatccgcaccagggctccgtctacgccgcc
tgcttctcccaggacggaaccaagatcgcctcgtgtggagccagcaagacgctcaaggtt
ttcaggagcacgtccggcgaaaagctgaccgagatccaagcccacgatgacgaggttctc
tgttgcgccttttcccccgacgaccgtctcctagcaacttgctccagcgacaggaaagtg
aaggtgtggaacgcagagcgtggcatgttgctgagggtctttgaggtggaacacgaggag
caggtcaaccactgccagttcaccaacacgcgacggcgtctcctgctggccacctgctcc
aatgacagtttcttgaacgtcaagctgtggaacctgaacaaacccacctcacagaacacc
atgtttgggcactttgaaccggtcaaccactgttgtttctcccccgacgacgcctatctc
tccacctcctccaacgacggcaccgtgaagatcttcgaagtgtcctccgccaacgagtgg
aagaccatcaacgtgcgggagtggtgcgcggaagccggcgaggaggttccggtcaagtgc
agcacgtggacgggcgacggcaaacgggtggtgtgcgccgtcaggagcgccgtgttggtg
atggacgtggagacgtcgcagatgctattagagatccgaacgggtcgcctgagcatggtg
cagtactgtgacgcgtgtcccaccagcaacctgctcgcgatcgccttctccaactatgcg
gtggagctgtgggacctggcggacaataagaagatggccgactgcagcggtcacctgagt
tgggtccagcgagtccagttctctcctgacggctcgcagcttctctcttgcgccgacgac
cagaccgtcaggctatggcagacggataaagtgcacaccacctccgcggtgcgcttgaaa
agagactcggatgctttctttgactcaggggaagatggccaattttttgtttcggcggca
gacaactgcaacagactgcaggtgcgcgctggcagagcgggttcactgcttttccagtca
gaggagatggcgtcgcggatccgatgcacgtgcttttgctcgaagcctttggccgtcgcc
ttcggcacagaggacggcaccgtggagattctggccatcccctctgggaaggttctcgcc
accctgctgggccacaccaagacggtgctgcactgccagttcctccacgccggccaaact
ctcatcacgtcatccgaggacaccaccattaatgtgtggaagtggcagtcgcacgagtgc
ctcgtgctgcggggccacaaggagcaagtgcgttgtttctctctgctgtcgcctgctgaa
acacgaatgctgtcctgctcgtttgacggcacggtcaaggtttgggagctggaaagcgga
gaggagttgcagcacatcgaggctcaccggggagccattttgtcttgccacgtctcccca
gatggacgtttctttgccaccacctctgctgacaagattgccaaggtctggtggcacagt
gagtcctggcaatgtgtccacgtactgtgcggccaccaagactgcgtccggagttgccgc
ttttcctgtgacgggcggcggctggcgacgggggatgacggcggcgagatccggctgtgg
agtgtcacggaaggcaccttgctgaagatatgctcgcgagacggaaaggacggcttagac
tcgttgcacggaggctgggtgaccgacctgcacttctccccggacgactccctcctggtg
tccaccgggggatacgtcaagtggtgggacgtggacaaaggtgaagccctgcagaccttc
tacccgaccggtagcgcgttgaagaaggtccacgtgtcacccgatttttccacattcgtc
actattgacaacatcggcatcctctacgtcctccagagagtggtatga

DBGET integrated database retrieval system