KEGG   Hippocampus comes (tiger tail seahorse): 109523748
Entry
109523748         CDS       T04969                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04012  ErbB signaling pathway
hcq04068  FoxO signaling pathway
hcq04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109523748
   04068 FoxO signaling pathway
    109523748
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109523748
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 109523748
NCBI-ProteinID: XP_019738685
LinkDB
Position
Unknown
AA seq 159 aa
MCNKMSDVRLSNASPPLERVDARQQDRVRPPVCRNLFGTPDPDEIRARLAATLKDDVRSF
VDRYNFDPVQDRPLPRGDVEWTEAREAPEFYSRPPHRRRRPPMEDSGESPRSQNRDSSMK
RPSDAAGLSSECPTKRSHSRGDDDDEPPPDAGGPAAEVQ
NT seq 480 nt   +upstreamnt  +downstreamnt
atgtgcaacaaaatgtcagacgtgcgcctttccaacgccagtccgccgctggagagggtc
gacgcgcggcagcaggaccgcgtccgacccccggtgtgcaggaacctcttcggcacacct
gacccggacgagatccgggcccgtttggcggccacactgaaggatgacgtgcgctcgttc
gtggaccgctacaacttcgacccggtccaagatagaccgctcccgcgcggggacgtagaa
tggacggaggcgcgggaggcgccggagttctactccaggccgccgcacaggaggcggcgg
ccgccgatggaagattccggggagtcgcctcggagccaaaacagagactcttcgatgaaa
agaccgtcggatgctgcaggtctgtctagcgagtgcccgacgaagcggtcgcattccagg
ggggacgacgacgacgagccgcccccggacgctggaggtccggcggcggaggtccagtga

DBGET integrated database retrieval system