KEGG   Hippocampus comes (tiger tail seahorse): 109525003
Entry
109525003         CDS       T04969                                 

Gene name
rchy1
Definition
(RefSeq) RING finger and CHY zinc finger domain-containing protein 1 isoform X1
  KO
K10144  RING finger and CHY zinc finger domain-containing protein 1 [EC:2.3.2.27]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
hcq04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109525003 (rchy1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109525003 (rchy1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hcq04121]
    109525003 (rchy1)
Enzymes [BR:hcq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     109525003 (rchy1)
Ubiquitin system [BR:hcq04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    109525003 (rchy1)
SSDB
Motif
Pfam: zinc_ribbon_6 zf-CHY zf-RING_2 zf-RING_5 zf-C3HC4_2 Prok-RING_4 zf-RING_UBOX zf-RING_4
Other DBs
NCBI-GeneID: 109525003
NCBI-ProteinID: XP_019740773
UniProt: A0A3Q2Z1H7
LinkDB
Position
Unknown
AA seq 269 aa
MAALVGCEHYARSCLLKAPCCGKLYVCRLCHDAEENHQMDRFKVEEVQCSECQTLQQAQK
ACQQCHVQFGEYYCDICHLFDKDKKQYHCQPCGICRIGPREKYFHCDKCNLCLAQDLQGN
HKCVENVSRQNCPVCMEDIHTSRIGAHVLPCGHLLHKSCFDDMVRTSAYRCPLCMHSVWN
MEEYWSQIDKEIAQSPMPIEYQGTTVKIMCNDCQAHCTVPFHVLGMKCTGCGSYNTAQDG
GLIQQHPEPDNDNEPETNAEHQHDQSESP
NT seq 810 nt   +upstreamnt  +downstreamnt
atggcggcgcttgtgggctgtgaacattatgcgcggagctgcttattaaaagcaccttgc
tgtggtaaactgtatgtatgtaggctgtgccatgatgcagaggaaaaccaccagatggat
agatttaaagtggaagaggtgcaatgttctgagtgccaaacattacaacaggcacaaaag
gcatgccaacagtgtcatgtgcagtttggggagtattactgtgacatttgtcacttgttt
gacaaggataagaaacagtaccattgtcaaccctgtggcatatgtaggatcgggccgaga
gagaagtatttccattgtgacaagtgcaacttgtgtttagcccaggacctgcaagggaac
cacaaatgtgttgagaatgtttccaggcagaactgtccagtgtgtatggaggatatccac
acttctcgaattggagcgcacgttcttccctgtggtcaccttcttcataagagctgtttc
gatgacatggtcagaactagtgcttatcgctgccctctttgcatgcactctgtctggaac
atggaggaatactggagtcagatcgacaaagagattgcccagtcaccaatgcccattgaa
taccagggtaccactgtcaaaattatgtgtaacgactgtcaagcccactgtacagtgcct
ttccatgtcctggggatgaagtgcactggctgcggctcctataacactgcgcaggatgga
ggtctcatccagcagcatccagagcctgataatgacaatgagccagagacaaatgcagag
catcaacatgatcaatctgagtcaccttga

DBGET integrated database retrieval system