KEGG   Hippocampus comes (tiger tail seahorse): 109525037
Entry
109525037         CDS       T04969                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 10B-like isoform X1
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04060  Cytokine-cytokine receptor interaction
hcq04115  p53 signaling pathway
hcq04210  Apoptosis
hcq04217  Necroptosis
hcq05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109525037
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109525037
   04217 Necroptosis
    109525037
   04115 p53 signaling pathway
    109525037
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109525037
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hcq04050]
    109525037
   04090 CD molecules [BR:hcq04090]
    109525037
Cytokine receptors [BR:hcq04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   109525037
CD molecules [BR:hcq04090]
 Proteins
  109525037
SSDB
Motif
Pfam: TNFR_c6 Death UPF0560 TYA
Other DBs
NCBI-GeneID: 109525037
NCBI-ProteinID: XP_019740824
LinkDB
Position
Unknown
AA seq 417 aa
MNTIPFVIFVLIWSFASTATFPRGGQDSQSIWTRHEAICRDGEYWNGKICCLNCPPGTYL
KSACTAPGEKGQCEKCADETYTQHANDLKQCITCTKCRPDQEIVWPCNRTQNTKCQCKEG
RFCAPEHACEMCNKCSRCEKDEKVVRNCSATSNTECKKIPLQSDSASGGSLSPSQPHLGN
TAIIVCSVLLVLFLLCGLIYWCTKKLARVLDNLGGCIFPLGSEENELKVEHALEGNNEQS
QKPGCSSLIFSQPRVRGQSSATMEDECQALCESHNSSANNSQQNLTSLPPAFPASAHRAS
LTAIQPDLREDEPFPELIPINGEESLRRCFQYFEEVDIDYYKRFFRQLELNSNVIKSKDP
LLYEDRIHELLNIWLEKEGKDASLNDLLKALLKFDQRRTAEIIKAKALKNGHYVLEN
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgaacacaatcccatttgtcatttttgtgttgatttggtcttttgcatccactgccacg
tttcctcggggtggccaagactcgcaaagcatctggacccggcatgaagccatctgcaga
gatggggagtactggaacggcaaaatctgctgcttaaactgcccacctggtacttatttg
aagtcagcctgcactgcgccaggtgaaaaggggcagtgtgagaaatgtgcagatgaaaca
tacactcaacatgccaatgacctcaagcaatgtatcacatgcaccaagtgccgtccagat
caagagattgtctggccttgtaaccgcacccaaaacaccaaatgtcagtgcaaagaagga
cgattctgtgcacccgaacatgcatgcgagatgtgcaataaatgttcaagatgtgagaag
gatgaaaaggttgttcgcaactgcagtgcgacctcaaacacggagtgcaagaaaatccca
ctgcagtctgactctgcctcaggtggttctctctctccttcccaaccgcatctaggaaac
actgccattattgtgtgcagtgtgctcctcgtcctttttctgttgtgtggactaatttac
tggtgtacgaagaagctggcaagagttttggacaatcttggtggttgcatcttcccctta
ggctctgaggaaaacgagctgaaagttgagcacgcgctagaggggaacaatgaacaaagc
caaaagccgggatgctccagtctgatcttttctcagccacgggtgagaggtcaaagctca
gccacgatggaggatgagtgccaagcgctgtgtgaaagccacaacagctctgccaataac
tcccaacaaaatctaaccagcctaccccctgccttccccgcctctgcccaccgagcgtct
ctgactgccattcagcccgatttgagggaggatgagccttttccagagctgattcctata
aatggtgaagaatctctcaggaggtgtttccagtatttcgaggaagtcgatatcgactat
tacaagaggttcttccgtcagcttgagctgaatagcaatgtgatcaaaagcaaagaccca
cttctctatgaagacaggattcacgagttgctgaacatctggttggagaaggagggcaag
gatgcaagtttaaatgacctgctgaaagcgttactgaagtttgatcaaagacgtacagct
gagataatcaaggcgaaagcactgaaaaatggccattatgttttagagaactag

KEGG   Hippocampus comes (tiger tail seahorse): 109526039
Entry
109526039         CDS       T04969                                 

Definition
(RefSeq) uncharacterized protein LOC109526039
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04060  Cytokine-cytokine receptor interaction
hcq04115  p53 signaling pathway
hcq04210  Apoptosis
hcq04217  Necroptosis
hcq05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109526039
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109526039
   04217 Necroptosis
    109526039
   04115 p53 signaling pathway
    109526039
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109526039
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hcq04050]
    109526039
   04090 CD molecules [BR:hcq04090]
    109526039
Cytokine receptors [BR:hcq04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   109526039
CD molecules [BR:hcq04090]
 Proteins
  109526039
SSDB
Motif
Pfam: TNFR_c6 Death
Other DBs
NCBI-GeneID: 109526039
NCBI-ProteinID: XP_019742592
LinkDB
Position
Unknown
AA seq 687 aa
MNTGPAVGKFCVLLATLLLLVSSPCRASEQPPSAQWSAPSDEAFKNLTVLRRHRTCVENQ
QYHYQGLCCLNCQAGTFVQKGCERDYQQGVCSPCKHGLTYTEHSNGMYRCLPCTHCRQDE
METASCTTTSDTKCQCRAGTFCVPDQACEVCKRCAKCKAGEEEVKKCTHFSNTVCRKRDP
FPTQTPLDRTPPTPTSPADIMVPVLSCLSIVVVVLAGLAAWCFVTKRCSFEGTCECAKSH
CDTSEIIKIPIDESAPTAEECQNSRNAGLEGDHSRPESRPLLQETQAGMTNNKASPSPED
EDRGLGDSLPNTTSSSQTSLSAMPTAASYVHSPAFFFGPTSMCLPCVWLTDEMETASCTT
TSDTKCQCRAGTFCVPDQACEVCKRCAKCKAGEEEVKKCTHFSNTVCRKRDPFPTQTPLD
RTPPTPTSPADIMVPVLSCLSIVVVVLAGLAAWCFVTKRCSFEGTCECAKSHCDTSEIIK
IPIDESAPTAEECQNSRNAGLEGDHSRPESRPLLQETQAGMTNNKASPSPEDEDRGLGDS
LPNTTSSSQTSLSAMPTAASSGDSPASCRISPAAIEDPLQHRLLPLQESEKSLKKSFDLF
DKYLDVRIHNKFFRMIGVSDNHIRLAENGAAGDKVYELLKNWMQRQGLKADINHLLQALL
DLDQRRSAESIASEALRRGYYKHDHAP
NT seq 2064 nt   +upstreamnt  +downstreamnt
atgaacaccgggccggctgtcgggaaattctgcgtgctgctggcgacgctcctccttctg
gtgagctctccatgccgagcgtccgagcagcccccctcagcccagtggtccgccccgtca
gatgaagccttcaagaacctgaccgtcctgcgccggcacaggacttgcgtggagaaccag
cagtaccactaccaaggcctctgttgcctcaactgccaggccgggacatttgtgcagaag
gggtgtgagcgtgattaccagcagggggtgtgctcaccttgcaagcatggactcacatac
actgaacactccaacggcatgtacagatgtctgccctgcacgcactgtcgtcaagacgag
atggagacagcgtcttgcaccaccacgtcggacaccaagtgtcagtgccgagcgggaacc
ttctgcgtgccagatcaggcctgtgaggtctgcaaacgctgcgccaagtgcaaagcgggc
gaggaggaagtgaagaagtgcacgcacttttccaacacggtctgccgaaagcgagaccca
tttcccacccaaacgccgctggaccgaaccccacccacccccacctcgccagcagacatc
atggttcccgtgctgagctgcctctccatcgtcgtcgtggtgttagccggattggccgca
tggtgcttcgtcaccaagcgctgctccttcgagggaacgtgtgagtgcgccaagagtcac
tgtgacaccagcgaaatcatcaagattcctatcgatgagagcgcccccacagctgaggag
tgccagaacagtcgcaatgccggcctggagggcgaccactcccgcccggagtcccgtccg
cttctgcaggagactcaggcaggcatgaccaacaacaaggcctcgccgtccccggaggac
gaggaccgcgggctgggcgacagcttgcccaacaccaccagctcttcacagaccagcctg
tcggcgatgcccaccgccgcctcatacgtacatagccccgcctttttttttggcccaaca
agtatgtgtctgccttgtgtgtggctcacagacgagatggagacagcgtcttgcaccacc
acgtcggacaccaagtgtcagtgccgagcgggaaccttctgcgtgccagatcaggcctgt
gaggtctgcaaacgctgcgccaagtgcaaagcgggcgaggaggaagtgaagaagtgcacg
cacttttccaacacggtctgccgaaagcgagacccatttcccacccaaacgccgctggac
cgaaccccacccacccccacctcgccagcagacatcatggttcccgtgctgagctgcctc
tccatcgtcgtcgtggtgttagccggattggccgcatggtgcttcgtcaccaagcgctgc
tccttcgagggaacgtgtgagtgcgccaagagtcactgtgacaccagcgaaatcatcaag
attcctatcgatgagagcgcccccacagctgaggagtgccagaacagtcgcaatgccggc
ctggagggcgaccactcccgcccggagtcccgtccgcttctgcaggagactcaggcaggc
atgaccaacaacaaggcctcgccgtccccggaggacgaggaccgcgggctgggcgacagc
ttgcccaacaccaccagctcttcacagaccagcctgtcggcgatgcccaccgccgcctca
tccggagatagccccgcctcctgcaggataagccccgccgccattgaggatcctctacag
caccgcctgctgccactgcaagagtctgagaaatcactgaagaagagcttcgacctgttc
gacaagtacctggacgttcggatccacaacaagttcttccgcatgatcggcgtgagcgac
aaccacatccgcctggcggagaacggcgcggccggtgacaaagtctacgagctgttgaag
aactggatgcagcggcagggcctgaaggctgacatcaaccacctgctgcaggccctgctg
gacctggaccagcgacgctcggctgagagcatcgcctcagaggcgctgaggcgaggctac
tacaagcacgaccacgctccctga

DBGET integrated database retrieval system