KEGG   Hippocampus comes (tiger tail seahorse): 109525295
Entry
109525295         CDS       T04969                                 

Gene name
chek2
Definition
(RefSeq) serine/threonine-protein kinase Chk2 isoform X1
  KO
K06641  serine/threonine-protein kinase CHEK2 [EC:2.7.11.1]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04110  Cell cycle
hcq04115  p53 signaling pathway
hcq04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109525295 (chek2)
   04115 p53 signaling pathway
    109525295 (chek2)
   04218 Cellular senescence
    109525295 (chek2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hcq01001]
    109525295 (chek2)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hcq03400]
    109525295 (chek2)
Enzymes [BR:hcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109525295 (chek2)
Protein kinases [BR:hcq01001]
 Serine/threonine kinases: CAMK group
  RAD53 family
   109525295 (chek2)
DNA repair and recombination proteins [BR:hcq03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    109525295 (chek2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr FHA Kinase-like Kdo Yop-YscD_cpl Pkinase_fungal RIO1 APH YrbL-PhoP_reg Pox_ser-thr_kin FTA2
Other DBs
NCBI-GeneID: 109525295
NCBI-ProteinID: XP_019741259
UniProt: A0A3Q2YG92
LinkDB
Position
Unknown
AA seq 518 aa
MSQDIPNKGDQPQSPSQAQSTLSPSQAQSKSQGGSSSSSGPTSGSQSSSGSGTLSSVDTL
PVTLPSVPEEPESQPWGRLLPMQNGFRAHDCVEDEYLFGRDSKCNYVLDDPDHKGSLRFR
IYSKKHFRIYREGTEVFVQDLSNNGTFVDGNKIGRNKKLPLVNNAVLALSEHRNKVFVFI
DLMSDQESTLPGELRDKYLLTRRIGTGVCGEVKLAFERSTCKKFAVKIINKSNFKSEGTA
TRNAQTEIEILQRIDHPCLIKTKDFYQTDDTFFIVLELMEGGELFNRLKTQQRLSEATAK
LYFYQMLKAVQYLHSQGIIHRDLKPENILLSSQEDDCLIKVTDFNQSRILEEAALMRTLC
GTPSYLAPEVLTHAATGGYGLPVDAWSLGVLLFVCLCGYPPFHENFSELSVSEQIMQGQF
TMVPSKWQHVSDQAKDVVRKLLVVAPANRMSIDEALQHAWMQDPVMLEKAHRLMYPSSDA
EDVAMEAGPAPSSSRKRLREDPDDEGRPAKQAPPTGMQ
NT seq 1557 nt   +upstreamnt  +downstreamnt
atgtcccaagacattccgaataagggggaccagccccagtccccctcgcaggcccagtcc
actctgtccccgtcgcaggcccagtccaagtcccagggcggctccagttcctccagtggc
cccacgtcaggcagccagtcatcaagtggctcggggacgctgagcagcgtggacacgctt
cctgtcaccttgccatccgtccccgaggagcccgaaagtcaaccttggggacgcctgctg
cccatgcagaacggcttccgcgctcacgattgcgtggaggacgagtatttgtttggccga
gactccaaatgtaattacgtcctggacgatccggatcacaaaggatccttacgatttcga
atttacagcaagaaacacttcaggatctacagggagggcaccgaggtgtttgttcaggac
ctgagtaacaacgggaccttcgttgacgggaacaaaatcggacgcaacaagaaacttcct
ctggtcaacaacgcagtgctggcgctgtcggagcatcgcaacaaagtgttcgtcttcatc
gacctgatgtctgaccaagagtccacgttgcccggggagcttcgtgacaaatatctgctg
actcgacggatcgggacaggggtgtgcggcgaggtgaagctggcgttcgagcgctccacg
tgtaagaagtttgcggtgaaaatcatcaacaagagcaacttcaagtctgaaggaacggcc
acaagaaatgcccaaacggagatcgaaattcttcaacgcatcgatcacccgtgcctcatc
aagaccaaggacttctaccagacggacgacaccttcttcatcgtgctggagttgatggag
ggcggcgagctgttcaaccgcctcaaaacgcaacagcgactgagcgaggccacggccaag
ctatacttctaccaaatgttgaaagccgtgcagtacctgcacagccagggtatcatccac
cgggacctgaaaccggagaacatcctcctgtcgtcgcaggaggacgattgcctcatcaag
gtgacggacttcaaccagtcgcggatcctggaggaggcggccctgatgaggacgctgtgt
gggacgccatcctacctggcgcccgaagttttgacgcacgccgccaccggcggatacggg
ctgcccgtcgatgcctggagcctcggcgtgctcctcttcgtctgcctgtgcgggtacccg
ccgttccacgagaacttctcggagctgtcagtgagcgagcagatcatgcaaggccagttc
acgatggtgccgtccaagtggcagcacgtgtccgaccaggccaaggacgtggtgaggaag
cttctggtggtggcgcctgctaacaggatgagcatcgatgaggcgctccagcacgcttgg
atgcaggaccccgtaatgttggagaaagcccatcgactgatgtatccatcttctgatgct
gaggatgttgccatggaagccgggccagcgccgtcgtcgtcaaggaaacgactgcgagaa
gacccggatgacgagggacgtcctgccaaacaagccccgcccactggcatgcaataa

DBGET integrated database retrieval system