KEGG   Hippocampus comes (tiger tail seahorse): 109525537Help
Entry
109525537         CDS       T04969                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal-like
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00052  Galactose metabolism
hcq00500  Starch and sucrose metabolism
hcq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109525537
   00500 Starch and sucrose metabolism
    109525537
Enzymes [BR:hcq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     109525537
    3.2.1.20  alpha-glucosidase
     109525537
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 109525537
NCBI-ProteinID: XP_019741660
LinkDB All DBs
Position
Unknown
AA seq 1823 aa AA seqDB search
MGKRKFSALEVTLMVLFALMLVIAIALIVLFVTGEPGAIRDEPTEVFVPQCPNIPLAERV
DCFPDAGASKKGCEQRGCCWSPLDERNVPWCFFSTNHGYTVESVEQPDPYIIQAHLKRMP
SPSLFGADIQELSFHAEMQTSNRLRFKIYDARMQRFEVPHEHVNNLSKHPTSPISNTLEL
THKPFGLLVRRKENKKVLFDTTMGPLVFADQFLQLSAKLPSHNIYGLGEHVHRRYRHDTN
WKTWPIFTRDAFPNGGTHNLYGHYPFFLSLEDESGKSFGVFLMNSNAMEVTLQPAPAVTY
RTIGGILDFYILFGDTPEQVVQEFLELIGRPVIPPYWSLGFQLSRWDYGSLSEVKKTVER
NRAVDLPYDIQYTDIDYMEEKKDFTYDKVKFSELPQFADYLHEKGQKYILILDPAIATSK
RVGGLPYESFDRGTEKKAWVTEKDGETPLLGEVWPGETVFPDYTSQNCIDWWTDEYKRFY
QEIKHDALWIDMNEVANFKKGSTKGCADNNLNYPPYTPKIQDEVMYSKTLCMDAKQAWGN
HYDVHSLYGYSMVLATEKALQHVFGGNRTLMLTRSSFPGVGKYSGHWLGDNAANWNDIKW
AIPGMLEFGLFGIPYIGADICGFFDDSSEELCRRWMQVGAFYPFSRNHNAQGYRPQDPAA
YGPGSALVESSKHYLRIRYTLLPYLYTLFFKASTTGETVVRPLMHEFYSDSATWGVDRQF
LWGKHLLITPVLDTGVVMLNAYIPDALWYDYETMKPLAVRRQNIQLHLPGDKLGLHIRGG
AVLPTQKPAVTTTYSRRNPMGLIIALDDRAQAAGELFWDDGDSRDTLKKGNYIHYKFTVL
YGVLTMQVMHAGYRDPNNLHFENITILGVPHPPLSASVTHVDSGSHENSTTIVPDSSIEY
DAAKEVLVLRHLSLTLGETYLVRWEVPQEEYQRFDCHPEEHADEAKCKARGCIWKQSNIE
RVPWCFYPKDYGYHVRLNEHTMSGIWFQITRNKRYQSRSRSESPDIDDLHVQVTYHSGNM
LQFKIWDPATARYEVPVPLSVPPVPETNEDRRLYKVLYKSDPFGIQVIRKSTGTVIWDSS
VPGFTFSDMFIQISTLLSSEYVFGFGETEHLTYKHDLNYHTWGMFAKDQPPGYKMNCYGV
HPFYMGLETTNDAHGVLLLNSNAMDVTFQPTPALTYRTVGGILDFFMVLGPTPENVVQQY
TALIGRPVLPAYWSLGFQLCRYGYANDKEIADLYTQMRDAGIPYDVQYADIDYMDRQLDF
VLDPEFAGLPSLVDDMRKEGMRFIFILDPAISGNETDYPAFERGNAADVFIKWPKTLSDD
IVWGKVWPDYPNVTVDESLDWDTQVELYRAFTAFPDFFRNATAKWWHQEIMDFYQTTMKF
DGLWIDMNEPASFVHGTAGGNCLGDPLLEKPPYMPPLDSKHLGLNHKTLCMNSEQILSDG
TTVRHYDVHSIYGWSHTKPTYDALLNVTGRRGIVVTRSTYPSSGKWAGHWLGDNNASWDQ
LYKSIIGMMEFSLFGIPYTGADICGFFNTAKYEMCLRWMQLGAFYPYSRNHNGKGNPRQD
PVAWNSTFAEASRKVLNIRYSLLPYLYTLMYEAHTKGNTVVRPLLHEFVNDRTTWDIYKQ
FLWGPALLITPALDPGATRVEAYVPDARWYDFHTAKEVKVRGEKVWMLTPMDHINLHIRG
GYILPWQKPENTTYYSRKNPLGLIVALSDNGTAHGSFFWDDGDGIDTVEKGQYLLTSCAV
ESNTLSSKTIRNGLFEADHLMLGIVKVWGIGTNITEVTLRDVTDTVHLLTPQYNADTEEL
IIDTTATSVRVDQGFTITWRASV
NT seq 5472 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaaggaaattctcggctttggaggtgaccttaatggtcctgttcgcattgatg
ctggtgatagcaattgctctaatcgttctttttgttaccggcgaacctggcgccattcgg
gatgagccaacagaggtgtttgttccacagtgtccaaatattcctcttgcagaaagagtg
gactgtttccctgatgctggagcctccaagaaaggatgcgagcaacgtggatgttgctgg
agccccctagatgagcgaaatgtaccttggtgcttcttttccaccaaccatggatacact
gttgagtccgtggagcaaccggatccttatataatacaggcacatctgaagagaatgccc
tccccttccttgtttggagcagatatacaggaactgtcatttcatgctgaaatgcaaaca
agcaatcgacttcgttttaagatatatgacgcccgcatgcagaggtttgaggtgccccat
gaacacgtgaacaacctcagcaagcacccgaccagtcccatcagcaacacactggagctc
acacacaaaccttttgggctgcttgtccgcaggaaggagaacaaaaaagtcctgtttgac
acaacgatgggaccattggtgtttgcagaccagttccttcagctgtctgcgaaacttcca
tcccataatatttatggcctgggagagcacgtacacaggcgttatcgccatgacacaaac
tggaaaacctggcccatctttaccagagatgcttttcctaacgggggaacacacaatctc
tatggacactatcccttcttcctctctctggaagacgagagtggaaagtcatttggggtc
ttcctcatgaacagcaatgcaatggaagtgacgttgcaacctgcacctgcagtgacatac
agaacaattggaggaatcctcgacttctatattctctttggagatacaccggaacaagtg
gtgcaggagtttcttgagctgattggcaggcctgtcattccgccctactggtcactggga
ttccagctttccaggtgggactatgggagcttgagtgaggtcaagaaaacagtggaaagg
aatcgtgcagtggacctcccctatgacatccagtataccgacattgactacatggaggag
aagaaagacttcacttatgataaagtcaagttcagtgagctgccccagtttgccgactac
cttcacgagaagggacagaagtacatcctcatcctggatccggctattgccaccagcaaa
agagtcgggggtctgccatatgagtcctttgaccgtgggacagaaaagaaagcctgggtc
actgaaaaagatggcgagactcctttattgggagaggtttggccaggagagaccgtattt
ccagactacaccagccaaaactgcattgactggtggactgacgagtataagagattctat
caggaaattaaacatgatgccctttggatagacatgaatgaagtggcaaacttcaagaaa
ggatcaactaagggctgtgcggataacaacttgaactatcctccctacacaccaaagatt
caggatgaggtgatgtatagtaagactctgtgtatggatgccaagcaagcctgggggaac
cactatgatgttcacagtctctatggctactccatggtgctggcgactgaaaaggctctg
cagcatgtgtttggtggcaaccgtactctgatgctgacccgctcgtcctttccaggtgtg
gggaaatattcaggtcattggctgggggacaatgctgccaactggaacgacatcaaatgg
gcaatccctggcatgctagaattcggtctatttggaattccatatattggagctgacatc
tgtggattttttgatgactcaagtgaagaattatgccgtcgctggatgcaagtgggagct
ttctatccattcagccgcaaccacaatgcccagggctacaggcctcaggatccagcagca
tatgggccaggctcggctctggtggagagctccaaacactacctgaggattcgttacaca
ctgctgccgtacctctacacacttttcttcaaagccagcaccacaggggagaccgtagtg
cgtcccctcatgcatgagttttactctgacagtgccacctggggtgtggatcgacagttt
ctctgggggaaacacctgctcatcactcctgtgctggacacgggtgtggttatgttgaat
gcttatatcccggatgcattgtggtatgactacgagacgatgaagccattggcagtgcgc
agacaaaacattcagctgcatctaccgggtgacaagcttggtttacacataagaggtggc
gcagttctccccacgcagaaaccagctgtcaccaccacgtacagtcgacgcaatccaatg
ggtctgatcattgctctcgacgaccgagcccaagccgctggggagttattctgggatgat
ggagattccagagacacgcttaaaaaaggcaactacatccactacaaattcacagttctc
tatggggtgctgaccatgcaggtgatgcatgctggctacagggatcccaacaacctacat
tttgagaacatcacaatcttaggcgttccccatcctcctctgtctgcctccgtgacacac
gtggactctggatcgcatgaaaactccacgacaattgttccagattccagcatcgagtat
gatgcagccaaggaggtcctggtcttacgacatctgtctttaactctgggggagacgtat
ctcgtgcgttgggaggtgccgcaagaggagtaccagcgctttgactgccaccccgaggag
catgcagatgaggcaaagtgcaaggcccgaggctgcatctggaagcaaagcaacattgaa
cgagttccctggtgcttctatccaaaagactacggataccacgtcagactaaatgagcat
accatgtctggcatttggttccaaatcactcggaacaaaaggtaccagagcaggagccgc
tctgagtcacctgacatagatgacctccatgttcaggtcacctaccacagcggtaacatg
ctgcagttcaagatctgggacccagccacagctcgttatgaggttccagttccgctgtct
gtcccacctgttcccgagactaatgaggacagacggctttacaaggtcctttataaaagt
gatccatttggcatccaggtcatccggaaaagcacagggaccgtgatttgggactcctct
gtgccaggttttaccttctccgacatgtttattcaaatatcaacacttctgtcatcagag
tatgtctttggctttggcgagacggaacatttaacatataaacatgacctgaactatcac
acctggggtatgttcgccaaagaccagcctcctggttacaagatgaactgctacggagtc
cacccattctatatgggccttgagaccactaatgatgctcatggtgtgctgctgctaaat
agcaatgcaatggatgtgacttttcagcctaccccagctttaacctatcgaactgtggga
ggcattctggatttcttcatggtcctgggacctacacctgagaatgtggtgcagcagtac
actgctctgattggaagacctgttctacctgcttattggtcccttggatttcagctctgt
cgctatggatatgctaatgacaaggagatagcagatctatacacacaaatgagggacgca
ggtattccctacgacgtgcagtatgcggacattgattacatggatcggcagctggacttt
gtcctggacccagagttcgctggtctaccttccctggttgatgacatgaggaaagagggc
atgaggttcatcttcattctggacccagccatttcaggcaatgagactgattatcctgca
tttgagaggggtaatgcagctgatgtcttcattaaatggcccaaaacactgagtgatgac
attgtgtggggaaaggtttggccagattacccaaacgtcacagtagatgagtctttggac
tgggacacccaagtagagctctacagggccttcactgccttccctgacttcttccgtaat
gcaacggcaaagtggtggcatcaagaaatcatggatttctatcagactactatgaaattt
gatggcctctggatcgacatgaatgagcctgccagttttgtacatggtacagccgggggg
aactgcctcggtgaccctctgcttgagaagcctccatatatgccacccttggattccaaa
catcttggcttaaatcataaaactctgtgcatgaacagcgaacagatactcagcgacggg
acaacagtcaggcactacgatgtccacagcatctacggctggtcccacacgaagcctact
tatgatgccctactgaatgtgactgggagacgaggtattgtggtgaccaggtccacttac
ccctctagtggaaaatgggctggacattggctgggtgacaacaatgccagctgggaccag
ttgtataaatccatcataggcatgatggagttcagtctttttggcatcccttatactgga
gcagacatatgcgggttcttcaatacagctaagtatgagatgtgccttcgctggatgcaa
ctgggtgccttctatccttattcacgtaaccataacggcaagggcaatccgagacaagat
cctgttgcctggaactccacctttgctgaggcatctcggaaagtcctcaacattcgttac
agccttctgccatacctgtacacgctcatgtatgaagctcataccaaaggaaacacagtc
gtcagaccacttctgcatgagtttgtgaatgacagaacaacttgggacatttacaaacag
ttcctctggggacctgctcttcttatcacccctgcccttgacccgggcgctacacgtgtc
gaagcctatgttcctgatgcacgctggtatgacttccatacggccaaagaagtcaaagtg
cgaggcgaaaaggtttggatgctcacccctatggatcacatcaatcttcacataagagga
ggatacatcttaccttggcaaaaaccagagaacacaacatactacagccgaaagaatcct
ttgggactgatcgttgccctgagtgacaatgggactgctcatggatcgttcttctgggac
gacggcgacggaatagacacggttgaaaaaggacaatatctgctgacctcatgtgcggtc
gaatcgaacactttgtcgagtaaaactatccgcaacggcttgttcgaagccgaccatttg
atgcttggtatagtgaaggtctgggggatcggcacaaacatcacagaggtgactctgagg
gacgtgactgacacggtacatcttctgacacctcagtataatgcggacactgaggagctg
attattgatacaacggcaacttcagttcgtgtggatcaaggatttactataacatggaga
gccagtgtctga

DBGET integrated database retrieval system