KEGG   Hippocampus comes (tiger tail seahorse): 109525772Help
Entry
109525772         CDS       T04969                                 

Definition
(RefSeq) potassium voltage-gated channel subfamily KQT member 1-like
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109525772
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans KCNQ_channel Ion_trans_2
Motif
Other DBs
NCBI-GeneID: 109525772
NCBI-ProteinID: XP_019742097
LinkDB All DBs
Position
Unknown
AA seq 624 aa AA seqDB search
MSNSARSQGTTQKCPDESREKRTSDWELFETNLGASDQHRSAMEATQIHLQPYLLQPRMF
GRMLVYNSRVRPVLTHASFQGRVYNFLERPSGWKCFVYHFTVFLVVIACLILSILSTMPI
YHLFSFSVLFWVEISLVVFLGLEYIFRLWSAGCRSMYVGFCGRLRFARKPIIIIDLIVVV
SSIIVLAVGSEGQVFATSAVRGIRFLQILRLLHVDRQGGTWRLLGSVVSAHRQELITTLY
IGFLCLIFASYLIYLAERETTGMLETYADALWWGVVTVTTVGYGDVIPLTWLGKIIASCF
SVFAICFFALPAGILGSGFALEVQQKQRRKHFNRQIPAAARVIQTSWRCFAMENCNSATY
KMFLRKRSNALNSSLSTPMPKKLEKCNEDTASNGLTVPNMVSVSSYDSDRNNFLSSDVCN
AMDTERSRGLLDVNPPSGLKRNCSFEDNLEQESERDSVLTAAISISQLTESHRRAIRVIQ
KMRYFVAKSKFQQARKPYEVRDVIEQYNHGHLNLMVRIKELQRRLDQSLGKITSFQTGTD
RAKDKGSNSIGSRLSRMEDKISHMDLMLNRIAQSLSILPDERDAIGGEREGRPKPPPGHS
SSVNRSQDGLPIYEQLSTKLDNSN
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaattctgcgcgctctcaggggaccactcagaagtgtccagatgagtcccgtgaa
aagagaacatcagactgggagctgtttgagaccaacctaggggcgtcagaccagcaccga
tcagcaatggaggcaacccaaattcatctccagccttacttgcttcaaccccgcatgttt
gggcgcatgttggtgtacaacagcagagtccgccctgtcctcactcacgcctctttccaa
ggacgcgtgtataactttttggaaaggccgtccggctggaagtgcttcgtttatcacttc
actgtgttcctcgtagttattgcttgcctgattctcagcattctgtcaaccatgcccatc
tatcacctcttttccttctcggttctcttctgggtggagatttcccttgtggtcttttta
ggtttggaatatattttccggctttggtcagcaggttgtcgcagtatgtatgttggcttc
tgtggacgactgcgatttgcaaggaagccaataattatcatcgatctcattgttgtggtt
tcctcaatcatcgtgttagcggttggctccgaaggacaggtgtttgcaacctctgctgtg
agggggatccgtttcctgcaaatactccgtctgctccatgtagaccgccagggaggaacg
tggcgtctcctggggtctgttgtctctgcccatcgccaggagctaatcacaacactgtat
attggctttctgtgcctcatcttcgcctcatatttgatctacctggcagaaagggaaacc
acaggcatgcttgaaacatacgctgatgccctgtggtggggagtggtaacagtgacaacg
gttggctatggagacgtcatacctctgacgtggcttgggaagatcattgcatcttgtttt
tctgtctttgccatatgcttctttgcactccctgcaggaatattaggctcaggctttgca
ctcgaggtgcagcagaagcaaagacggaaacattttaacagacaaatccctgctgctgct
cgtgtcatccagacatcatggagatgctttgcaatggaaaactgcaattcggccacgtat
aagatgtttttgaggaagagatctaacgctcttaactcttcactgtcgactccaatgccg
aagaaattggagaagtgtaacgaggacactgcttcaaatggtctcacagttccaaacatg
gtctctgtctcttcttatgacagtgacaggaacaactttttgagttctgacgtgtgcaac
gctatggacaccgagaggagccgtggccttctggatgttaaccctccctctggcctgaag
aggaactgcagttttgaagacaaccttgagcaggagtcggagcgagacagtgtactgacc
gcagctatctccatatcacaactaactgaatcccatagacgggctatccgtgtgatccag
aaaatgcgctattttgtggcgaagagcaagttccagcaagctcgtaaaccatatgaagtc
cgagatgtgattgagcaatacaaccatggtcatctcaacctaatggtgcggatcaaggaa
ctccagagaagactcgaccagtcattaggcaagataacttcatttcagacaggaactgat
cgggccaaagacaagggaagcaactctattggatcccgactcagcaggatggaggacaag
atctcacacatggatctgatgctgaaccgcattgcacaatctctcagtattctgccagac
gagagggatgccattgggggcgaacgtgagggaagaccgaagccaccgcctggccacagc
agcagtgtcaatcgcagtcaggatggtctcccaatctatgagcagctgtctaccaagttg
gacaacagcaactga

DBGET integrated database retrieval system