KEGG   Hippocampus comes (tiger tail seahorse): 109526325Help
Entry
109526325         CDS       T04969                                 

Gene name
gck
Definition
(RefSeq) glucokinase isoform X1
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00010  Glycolysis / Gluconeogenesis
hcq00052  Galactose metabolism
hcq00500  Starch and sucrose metabolism
hcq00520  Amino sugar and nucleotide sugar metabolism
hcq00524  Neomycin, kanamycin and gentamicin biosynthesis
hcq01100  Metabolic pathways
hcq01200  Carbon metabolism
hcq04910  Insulin signaling pathway
Module
hcq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hcq_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109526325 (gck)
   00052 Galactose metabolism
    109526325 (gck)
   00500 Starch and sucrose metabolism
    109526325 (gck)
   00520 Amino sugar and nucleotide sugar metabolism
    109526325 (gck)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    109526325 (gck)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109526325 (gck)
Enzymes [BR:hcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     109526325 (gck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 FGGY_N
Motif
Other DBs
NCBI-GeneID: 109526325
NCBI-ProteinID: XP_019743123
LinkDB All DBs
Position
Unknown
AA seq 523 aa AA seqDB search
MPHWHADLTDSAYTHTHTYAHTRTPWTLTTLLETHLLVKMPCVSSCLEQMVKTSSGLSCV
FDRHDFMVDQILSELRLQKDELQEIMKRMRREMDRGLRLETHEVASVKMLPTYVCSTPEG
SVCVWAEVGDFLALDLGGTNFRVMLVKVGADEERSWKVETKNQMYSIPEDAMTGTAEMLF
DYIAECMSNFLDQHNIKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNNVVG
LLRDAIKRRGDIEMDVVAMVNDTVATMISCYYEDRSCEVGMIVGTGCNACYMEEMSTVEL
VEGEEGRMCVNTEWGAFGDNGELEEFRLEYDRVVDETSINPGQQLFEKLISGKYMGELVR
LVMMKLVNENLLFNGEASEMLKTRGSFETRHVSQVESDSGDRKHIYNILSSMGVLPSELD
CDIVGLVCESVSTRSAHMCAAGLAGVINLMRERRGLEALNITVGVDGSVYKMHPCFRDRF
HKIVRELTPHCEITFIQSEEGSGRGAALISAVACKMAASMLAR
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgccacactggcatgcagacttgacagactctgcatatacacacacacacacatatgca
cacacacgtacaccgtggacactcactacacttttagaaacacatttgctggtgaagatg
ccatgcgtgagctcatgtctggagcagatggtcaagacgtcaagtggcctcagctgtgta
tttgatagacatgacttcatggttgatcaaatcttgtccgagctcaggctgcagaaggat
gagctgcaagagatcatgaaaaggatgcggcgtgagatggacagaggcttgcgtttagag
acgcacgaggtggccagcgtcaaaatgctgcccacttacgtttgctccacccccgaggga
tcagtttgcgtttgggcagaggtgggtgacttcctggctctggacctgggggggaccaac
ttccgggtgatgctagtcaaggtgggagctgatgaagagaggagctggaaggtcgagacc
aagaaccagatgtattccattcctgaagatgccatgacgggaactgcagagatgttgttt
gactacatcgcagagtgcatgtctaacttcttagaccagcacaacatcaagcacaagaaa
cttcctctgggttttactttctctttcccggtgcgtcacgaggacatcgacaagggaatc
ctactcaactggaccaaaggtttcaaggcctctggggcagaggggaacaatgtcgtgggg
ttgctcagagacgctatcaagagacgaggggacattgagatggacgtcgttgccatggtg
aatgacacagtggccaccatgatttcgtgctactacgaagaccgcagctgtgaagtggga
atgattgttggtacgggttgtaacgcttgttacatggaggagatgagcacggtggagctg
gtggaaggcgaggagggccgcatgtgtgtcaacacggagtggggggcatttggagataac
ggcgagctggaggagttcaggctggagtacgacagggtggtggacgagacctccatcaac
cctggacagcagctctttgagaagctgatcagcggcaagtacatgggcgagctggtgagg
ctcgtcatgatgaagctggtcaacgagaacctgctgttcaacggcgaggcctcggagatg
ctcaagacgcgcggcagcttcgagaccagacatgtctcgcaggtggaaagtgactcgggt
gacaggaagcacatctacaatattttgtcatcaatgggtgtgctcccgtccgagctggac
tgcgacatcgtgggtctggtctgcgagagcgtctctactcgctctgcccacatgtgtgcc
gccggcctcgctggcgtcatcaacctgatgagggaacgacgtggcctggaggcactcaac
atcaccgtgggtgtggatggctccgtttacaagatgcacccatgctttcgtgacaggttc
cacaaaatagtcagagagctgacgccacattgtgagattaccttcatccagtcggaagaa
ggaagcggtcgaggggcggctctcatttcagcggtggcctgcaagatggcggccagcatg
ctggcgcggtga

DBGET integrated database retrieval system