KEGG   Hippocampus comes (tiger tail seahorse): 109526518Help
Entry
109526518         CDS       T04969                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN-like
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00562  Inositol phosphate metabolism
hcq01100  Metabolic pathways
hcq04068  FoxO signaling pathway
hcq04070  Phosphatidylinositol signaling system
hcq04115  p53 signaling pathway
hcq04140  Autophagy - animal
hcq04150  mTOR signaling pathway
hcq04218  Cellular senescence
hcq04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    109526518
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109526518
   04070 Phosphatidylinositol signaling system
    109526518
   04150 mTOR signaling pathway
    109526518
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109526518
  09143 Cell growth and death
   04115 p53 signaling pathway
    109526518
   04218 Cellular senescence
    109526518
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109526518
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hcq01009]
    109526518
Enzymes [BR:hcq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     109526518
    3.1.3.48  protein-tyrosine-phosphatase
     109526518
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     109526518
Protein phosphatases and associated proteins [BR:hcq01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    109526518
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 109526518
NCBI-ProteinID: XP_019743404
UniProt: A0A3Q2YMG2
LinkDB All DBs
Position
Unknown
AA seq 407 aa AA seqDB search
MAALIKEIVSRKKRRFQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDAK
HKSHYKIYNLCAERHYDTSKFNCQVAEYPFEDHNPPQLELIKPFCEDLDAWLSRDEQHVA
AIHCKAGKGRTGVMICAYLLHRGKFREAREALDFYGEVRTRDKKGVTIPSQRRYVCYYNT
LLRSRLHYSPVALLFHKMLFETIPMFTGGTCNPLFVIYQLKVKIHTSNPAFTRREDKLML
FEFPQPLPVCGDIKVEFFHKQNKMMKDKMFHFWVNTFFIPWPDEDPQRLENGQSGTLRDA
GSDRTQQNQECGGNDDDDFLVLTLMKNDLDKANKDIANRNFSPNFKVKLFFTKTADEGGG
SDREANSASVTPDVSDNEPDHYRYSDTTDSDPENEPSDDDRDQITKV
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgctcatcaaagagatcgtcagcagaaaaaaaagacggttccaggaggacggc
ttcgacctggacctcacttacatctaccccaacatcatcgccatgggcttccccgccgag
cgtctggaaggcgtctacaggaacaacattgacgacgtcgtgcggtttttagacgcaaag
cacaagagtcactacaagatctacaacttgtgtgcggagcgacattacgacacgtccaag
ttcaactgtcaagtggccgagtacccgttcgaggaccacaacccgccgcagctggagctg
atcaagcccttctgcgaggacctggacgcgtggctgagccgtgatgagcagcacgtggcc
gccatccactgcaaggccgggaaaggccgcacgggcgtcatgatctgtgcctacctgctg
caccgcgggaagttccgcgaggctcgtgaggccctcgacttttacggcgaagttcgcacg
cgggacaagaagggcgtgaccatccccagccagcgtcgttacgtgtgctactacaacacg
ctactgaggagcagactccactactcgcctgtggctttgctcttccacaagatgctcttt
gaaaccattcccatgttcacgggggggacctgcaatcccctgtttgtcatctaccagctg
aaggtgaagatccacacgtccaacccggcgttcacgcgccgcgaagacaagctgatgctc
ttcgagttcccgcagccgcttcccgtgtgcggcgacatcaaggtggagttcttccataag
cagaacaagatgatgaaggacaagatgttccacttttgggtcaacacctttttcattccc
tggcctgatgaggacccgcaaaggctggagaatggccaaagcggaaccttgcgggacgcc
ggatcggacaggactcagcagaaccaggaatgcggcggcaacgatgacgacgacttcctg
gttctgactttaatgaagaacgacctggacaaggccaacaaggacatagccaacagaaac
ttctcgcccaactttaaggtgaaactgttcttcaccaagacggcggacgaaggcggcggc
agcgaccgcgaggcaaacagcgcgtcggtgacgccggacgtcagcgacaacgaacctgat
cactaccgctactcggacaccaccgactcggaccctgagaatgagccctctgacgacgac
cgtgaccagatcaccaaggtgtga

DBGET integrated database retrieval system