KEGG   Hippocampus comes (tiger tail seahorse): 109526640
Entry
109526640         CDS       T04969                                 

Gene name
tp73
Definition
(RefSeq) tumor protein p73 isoform X1
  KO
K10148  tumor protein p73
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109526640 (tp73)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hcq03000]
    109526640 (tp73)
Transcription factors [BR:hcq03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    109526640 (tp73)
SSDB
Motif
Pfam: P53 P53_tetramer SAM_2 SAM_1
Other DBs
NCBI-GeneID: 109526640
NCBI-ProteinID: XP_019743608
LinkDB
Position
Unknown
AA seq 601 aa
MYYVKKKSQYNLLSSSSMDSLGSRARPASPYSSENASSAVPTPSPYSQPNSTFEGLSPAP
AIPSNTDYPGPHAFQLSFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKLSSSPPHGS
IIRAMPVYKKAEHVTEVVKRCPNHELGREFNDGQAAPASHLVRVEGNNLCQYMDDPITGR
QSVFVPYETPQVGTDFTTILYNFMCNSSCVGGMNRRPILIIITLESRDGQVLGRRSFEGR
ICACPGRDRKADEDHFREQQVLNDTVAKNGSANKRNFKQSPPNISSPNVNLRKRRHGDEE
IYYIPVRGRDNFELLMKIKDSLELVELVPQPLVDSYRQQTQQQLLQRPSHIASPSSPLSN
MNKHHPHGGLGKSQTANHLVGTQPQHHPTSHTSMAHMSHNVLNSHHMQSNGDMNGGHSSQ
TLVSASHCSPPPPYNPDPNLVSFLTSLGCQNFIEYFTSQGLQTIYHLQTLSVEELGALKI
PEQTRVAIWRGLQDMKQSTPLQLPASAHHHDYHGQQLLRSSSNVAAIGAAGGELQRQRVM
EAVHFRVRHTITIPNRSGVVGTTGMSAATDEWADFGFDMPDCKVARSKHPIKEEFMERDV
R
NT seq 1806 nt   +upstreamnt  +downstreamnt
atgtactacgtgaaaaagaagtcccagtacaacttgctcagcagcagcagcatggatagt
ctggggagcagggccaggcccgccagcccttacagctccgagaacgcttcttcggccgtg
cccaccccttcgccctactcccagcccaactccaccttcgagggcctgtcgcctgccccg
gcaatcccctccaatactgactacccgggaccccacgccttccagttgtcctttcaacag
tccagcactgccaagtcggccacatggacatactccccgctgctgaagaagctctactgc
cagattgccaagacgtgtcccatccagatcaagctgtcctcttcccctccccacggaagc
atcatccgagcgatgccggtctacaagaaggccgagcatgtgacagaagtggtcaagcgt
tgccccaaccacgagctgggtcgagagtttaacgacggccaagcagcaccagccagccat
ctcgtccgagtggaggggaacaacctctgccagtacatggatgatcctataaccggccgc
cagagtgtctttgttccctatgagactccacaggtggggacagacttcaccaccatcttg
tacaacttcatgtgcaacagcagctgtgtgggcggcatgaacaggagaccgatccttatc
attattacgttggaatcgagagatggacaagtgttaggtcgaaggtcatttgaaggccgg
atatgtgcgtgtcctggccgagaccgcaaagcagatgaggaccacttcagggaacagcaa
gtcttgaatgatactgtggcaaagaatggcagtgccaataagcgcaatttcaaacagagc
ccaccaaatatttccagcccaaatgttaaccttaggaagcggcgacatggggatgaggag
atttactatattcctgttcgtggtcgagacaattttgagctgctgatgaagattaaagac
agtttggaactggtggagcttgtccctcagccacttgtggactcctacaggcaacaaaca
caacagcagctgctacaaagaccgagccacatagcatctccctcctctccattgtcaaat
atgaacaagcatcacccacatggaggtctcggtaaatcccagacagccaaccacctggtg
gggacacagccccagcaccaccccactagccacacctccatggcacatatgagccacaac
gtgctcaacagccaccacatgcagtcaaacggtgacatgaacggtggccacagcagtcag
actttagtgtctgcttcacattgcagcccaccccctccgtataaccctgaccccaacctt
gtcagctttctaaccagcctgggctgccaaaacttcattgaatacttcacctctcaaggc
ctgcaaactatctaccatctccagacactctccgtggaggaattaggcgcactgaagatc
ccagagcagactcgcgttgccatctggcgaggactccaggacatgaaacaaagcactccc
ctccagctgcctgcctccgcacaccaccacgactaccacggccaacagcttctacgctcc
agcagcaacgtggccgccatcggggccgctggcggggagttgcaacgtcaacgcgtcatg
gaggccgtgcactttcgcgtccgccacaccattaccatacccaacaggtcaggcgttgtg
gggacgacggggatgtcggcagcgaccgacgagtgggcggactttggtttcgacatgccc
gactgcaaggtggcacgcagcaagcacccgataaaagaggagttcatggaaagagatgtt
cgctga

DBGET integrated database retrieval system