KEGG   Hippocampus comes (tiger tail seahorse): 109526720Help
Entry
109526720         CDS       T04969                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 2-like
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Brite
Enzymes [BR:hcq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     109526720
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 109526720
NCBI-ProteinID: XP_019743735
LinkDB All DBs
Position
Unknown
AA seq 685 aa AA seqDB search
MPHYRGEILDVDLRCRDNNLAHHTGEIDRERLIVRRGQPFVISVPWSESALHENSLALVL
HLGKRDEVVIRVEKGGHNKDGWWFKQEGRHGEVLLTLHSPADAIIGHYRLDVLMTSPSGH
VLEKKENINFHLLYNPWCKDDAVYIPDEKLVQEYIMNENGIIYVGTSDYIHSRHWHFGQF
EDNVMDICFEILDNSNDALRNSEKDLKQRWDPVYVGRIISAMVNSNGDRGVLVGRWQEPY
SDGVSPSKWTSSVPILQKWSNGRARPVKYGQCWVYAAVACTVLRCLGIPTRHITNFASAH
DTDGNLSVDFLFNEKMESLDSRGRSDSSWNFHCWVESWMKRQDLPQGNDGWQVLDPTPQE
LSDGEFCCGPCPVTAIKEGNLGVKYDAPFIFAEVNADIIHWIVRRDGQRQKIRVSQDSIG
VNISTKSVFSNSREDVTSHYKYPEGSKKEREVYEKAGRRGREPSTDRTKPGKMQMTIKHA
KPVFGSDFDVIVELKNDGGVQAEARLTMLAKAVTYNCLNRGEFERQTKNVSVPPHKVHKE
VLRVRYADYAKCVSEHHVVKVMALLETQGENEPDMAVAKIPLSLPELLVEVPSKAVVHQA
VTGSISFTNPLPVPLRRGVFTVEGAGLVSPTEVKMNGEIGPGQKVCVKLTFTPARAGMRK
LLVDFDSDHLQDVKGAATLIVGQYF
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgccgcattacaggggtgagattttggatgtggacctgagatgtcgtgacaacaacttg
gctcaccacaccggggagatcgatcgtgagcgcttgattgtgcgaaggggtcagcccttc
gtcatctcagtgccgtggtcagagtctgcgctccatgaaaactccctggctttggtcctg
caccttggcaagcgagatgaggtggtgatcagggttgagaagggcggacacaacaaagat
ggttggtggtttaagcaggagggaagacatggagaagtgctgctgactctccacagccca
gcggacgccatcatcggccattaccgcctggacgtgttgatgacatcacccagtggacat
gtgcttgagaagaaagagaacattaacttccatctgctttacaacccatggtgcaaagat
gatgctgtgtacattcccgatgagaagctcgttcaggaatatatcatgaatgagaatggg
atcatttatgttggcacctcggactacatccatagccgccattggcactttggacagttc
gaagataatgtgatggacatctgttttgaaatcctggacaactccaatgatgccttgaga
aactcagagaaggacttgaaacaaaggtgggacccggtctacgttggcaggatcatctct
gccatggtaaactccaacggtgatcggggcgtgttggtgggccgctggcaggagccgtac
agtgatggagtctcgccttccaaatggaccagcagtgttccgatcctccaaaagtggagc
aatggcagagccaggccggtcaaatacggccagtgttgggtctatgctgctgtggcctgc
acggtactgcgttgcctgggaatcccaacacgtcacattaccaactttgcttcagctcat
gacactgatggaaacctttctgtggacttcctgttcaatgaaaaaatggagagtcttgat
tcaagaggaaggtccgacagcagctggaacttccactgttgggtggagtcttggatgaag
agacaggatcttccacagggaaatgatggctggcaggttttggacccaactcctcaagaa
ttaagtgatggggagttctgctgtggtccatgtcccgtgacagccatcaaggagggcaat
ctgggtgtcaagtatgatgctccgtttatatttgctgaggtgaacgctgacatcatacac
tggattgtccgaagagatggccaacgtcagaagatcagagtgtctcaggacagtattggc
gtaaacataagcaccaaaagtgttttcagcaacagcagagaagatgtcacttcacattac
aaatatccggaaggctccaagaaagagagagaggtgtacgagaaggcgggacgtcgaggc
agagagccgtccactgacaggacaaaaccaggcaaaatgcagatgaccatcaaacatgcc
aaacctgtattcggatcagactttgacgtcattgttgagttgaagaatgacggaggagtc
caagctgaagctcgtctgaccatgctggccaaggcagtaacatacaactgtttaaaccga
ggagagtttgagagacaaaccaagaatgtctctgtgccaccccacaaagttcacaaggag
gtgctgcgcgtgcggtacgctgactatgccaagtgtgtctctgagcaccatgtggtcaag
gtgatggcgctcctggagacccagggagagaatgaaccggatatggccgtggccaaaatc
ccactcagcttgcctgagttgcttgtagaggttcctagtaaggcagttgtacatcaagcg
gtgacaggctccatctcctttaccaaccctctaccggtgccactgaggcggggagttttc
accgtggaaggggcaggcttggtgtccccgactgaggtcaagatgaacggtgaaattggc
ccaggtcagaaagtgtgcgtcaagctcacctttacccccgcgcgggctggcatgaggaaa
ctgctggtggactttgactcagaccatctccaagacgtgaagggagccgctacactgatt
gttggccaatatttctag

DBGET integrated database retrieval system