KEGG   Hippocampus comes (tiger tail seahorse): 109527076Help
Entry
109527076         CDS       T04969                                 

Definition
(RefSeq) histone-lysine N-methyltransferase EHMT1-like
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    109527076
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hcq03036]
    109527076
Enzymes [BR:hcq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109527076
Chromosome and associated proteins [BR:hcq03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109527076
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank SET Ank_5 Ank_3 Pre-SET
Motif
Other DBs
NCBI-GeneID: 109527076
NCBI-ProteinID: XP_019744324
LinkDB All DBs
Position
Unknown
AA seq 1245 aa AA seqDB search
MLNGTECDDARHNSPTCVSTTGHGMELALVNENGTSDMETPHGSVTGSNGFILIKPQQED
SSEATPDMANSPHRTNRPPSNTPTGVHLTKSPPSSASGSPQTLGALRTDPITGTTTELET
IDSKNGTAATTTASTTIMIHRARKTMSRPAVTLEQKLLKKELREAKNTVMETPVSPDTPN
PSQQCSTENHLPQNPSDLPASAQTASPTSPATPVDSSPPLTSTPSNLQHGLAGLFTGGLS
SRKKKRRMGIYSLVPKKKPKILRQTTMLEMFQVVHPNAKSPETNLNINGEKMDHASEEEE
VSDELDSEEEQQSQGEELGTDIVQTSPTFESPSQAENEQDSDESGEDEEEEGTDSDYLST
ESSLKKSKRKTKGDDAWLRPSRKCKRMAMEKDPESLAEPPAAFLMHSEDRNEHSEITPPD
KLSLHEPDASSDGKESSSSTVEEAQELPLCSCRMETPKSREILILADRKCMATDSVDGQL
TRCQGAVLKQEMMRPSNSVQLLVLCEDHRNGMVKHQCCPGCGFFCRAGTFMECQPDMNIS
HRFHRACASVLKGQSFCPHCGEEAGKAKEVTIAKADTTSTVPPTPAHGPAPPGAHEGRAD
TTTGSSLQPAVASDGNGRADSSLCAGLAPGLDSLAVSGSSGGTEQPGDVEATAPSPILPR
ETLESILVALDTEKPKKLRFHPKQLYLSAKQGELKKVVLMLVDGIDPNFKMESQNKRTPL
HAAAEGGQKEICHMLVQAGANLESCDEDHRTPLMDACENNHMETVMYLLRAGASAMHKDV
EGFTCLHLAAKSGHYNIVEYLLCTGYVNINCQDDGGWTAMIWATEYKHVNQVKLLLSKGA
DISIRDKEENIVLHWAAFSGSVEIATLLLDAHCDLHAVNIHGDSPLHIAARENRLDCVVL
FLSRGADVSRKNREGEAPPDCCSHNSKTFAALQANRRQKDAKNVGFIQAMEKSLHSDIAL
GQESVPLPCVNAVDGEPYPDDYKYILENCVTSPMNIDRNITHLQYCVCKEDCSSSVCMCG
QLSLRCWYDAGGCLLPEFCREEPPLIFECNHACSCWRTCKNRVVQNGLRTRLELFRTSKK
GWGVRALQDIPQGTFVCEYVGEIISEAEAEMRQNDAYLFSLDDKPQDLYCIDARFYGNIS
RFLNHMCEPNLFACRVFTTHQDLRFPHIAFFASENIKAGEELGFNYGDHFWEVKSKVFSC
ECGSSKCKYSSAAMTSLQADSTPESQQQPSASPDTSSSDAPSSPS
NT seq 3738 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatggcaccgaatgtgacgacgcaaggcacaacagcccgacgtgcgtttcgaca
acaggccacggcatggagttagcattggtaaatgaaaatgggacgtcggacatggagacg
ccacacggttctgttactgggagcaatggatttattctcattaagccgcaacaggaggac
agctcggaagccacgcctgatatggcaaattccccccacaggactaaccggccaccttca
aacacccccacaggggtacacttgaccaaatctcccccttcctcagcctccgggtcccct
cagactttaggtgcactaaggaccgaccctattacaggaactacaacagagctggagaca
atagactctaaaaatggcacagccgccactaccacagcttcaacaaccatcatgatacac
agagctcgcaaaaccatgtcgaggcctgctgtcactctggaacaaaagctcctcaagaag
gaattaagagaagcaaagaacaccgtgatggaaactccggtttcacccgacacgccgaac
ccttcacagcagtgctcaacagagaaccatctacctcagaatccttcggatctgccagct
tcagcacaaactgcttcgccgacttcaccagcaactcctgtagattcttcccctccgctc
acgtcgacgccctccaaccttcaacatggtctcgcaggtctcttcacaggggggctctct
tcccgtaagaagaagagaaggatgggaatttacagcctggttcctaagaagaaacctaaa
attcttcggcagacaacaatgttggaaatgtttcaggtggtacacccgaatgccaagagc
ccggagacaaatctaaacataaacggggagaagatggatcatgcatctgaggaagaggaa
gtgtcagatgagctggactcggaggaggaacaacagtcgcaaggagaggaacttggcacc
gatatcgtgcaaacgagtccaacatttgagtctccgtctcaggcggagaatgagcaggat
tctgacgaatctggagaagatgaagaggaggaaggcacggattcagattacttgagcacc
gagtccagtctaaagaagtcaaagaggaaaacaaaaggagacgatgcctggctcaggcca
tcgaggaaatgcaagaggatggcaatggagaaagacccagagtccttggctgagcctcct
gctgcatttctgatgcactcagaagacagaaatgaacactccgagatcacaccacccgac
aaactctcactccatgagcctgacgccagttcagatggcaaagagagctcgagttcaaca
gtggaggaggcccaggagctaccactgtgcagctgccgcatggagacccccaagagtcgg
gagattctcattctggctgacaggaagtgcatggctacggacagtgtcgatggacaattg
acccgctgccagggcgctgtcttgaaacaagaaatgatgcgtccctccaactctgttcag
ctgctcgttctatgcgaggaccaccgcaacggcatggtcaagcaccagtgctgccccggc
tgcggcttcttctgcagggctgggaccttcatggagtgccaaccagacatgaacatctcg
catcgctttcaccgcgcctgtgcctcagtgctgaaaggtcaaagcttctgcccccactgc
ggggaggaggccggcaaggccaaggaggtgaccatcgccaaggctgacaccacctccact
gtaccccccacacctgcccacgggccagctccgcccggggcccacgagggccgagcggac
accactaccggaagctctttacagccggctgtggcgagcgacggcaacgggagagcagac
agctcgctttgcgctggtttggcgccggggctcgactccctcgctgtttcgggatcctcc
ggcggcacggaacagccgggcgacgtcgaagcgacagccccttctccgattcttcctcga
gaaactcttgaaagcatcctagttgctcttgacacggagaaacccaagaagctgcgtttt
cacccaaagcaactttacctctcggccaaacagggagagctgaagaaggtcgtgctcatg
ctggtggacggtatcgaccccaactttaagatggagtctcagaacaaacgcacccctctc
catgctgcagctgagggaggacaaaaggaaatctgccacatgcttgtgcaagccggcgca
aacttggaaagctgcgacgaagatcatcgaacaccgctgatggacgcctgcgaaaacaac
cacatggagacggtcatgtacctgctgagagctggagccagcgccatgcacaaggatgtt
gaagggttcacatgtctccacctagcggccaagtctggtcattacaacattgttgagtac
ctcctgtgtacaggatacgtcaacatcaactgtcaggatgatggaggatggacagccatg
atttgggccacagagtacaaacatgtgaaccaggtcaaattgcttctgtccaaaggagct
gacatcagcatcagagacaaggaagaaaacatcgttcttcactgggcagcgttctctggc
agcgttgagattgccacactgctcctggacgcgcactgtgatctccacgctgtaaatatc
cacggggactctcctctgcatatcgccgctcgggagaatcgcctggactgtgttgtgctt
ttcctatctcgaggagcagatgtttcccgaaagaatcgcgaaggagaagcgcctccggac
tgctgcagccacaactcaaaaacgtttgcggccctgcaggccaacaggagacagaaggat
gccaagaacgtcgggttcattcaagcaatggaaaaaagccttcacagcgacattgccctc
gggcaggagagcgttccccttccctgtgtcaatgccgtcgacggtgaaccttacccggac
gactacaagtacatccttgaaaactgcgtcacctccccgatgaacatcgatagaaacata
acccacttgcagtactgcgtttgcaaggaagactgttcttcaagcgtctgcatgtgtgga
cagctcagtctgcgctgctggtatgatgcgggcggttgtcttctccctgaattctgccgt
gaggagcccccgcttatctttgagtgtaaccacgcctgttcctgttggaggacctgcaag
aacagggtggtgcaaaacggactcaggaccagacttgagctctttcggaccagtaagaag
ggctggggtgtccgggcactacaagacataccgcaagggacctttgtatgcgagtacgtc
ggtgagatcatctccgaagccgaagctgagatgaggcaaaatgatgcgtacctcttcagt
ttggatgacaagccacaagatctttactgcatcgatgcgcgtttctatggaaacatcagt
cggttcctcaaccacatgtgcgagcccaacttgtttgcctgccgagtgttcaccacacac
caggacctgcgtttcccacacatcgccttctttgccagtgaaaacatcaaggcgggagaa
gagcttggatttaactacggcgaccacttttgggaagtgaaaagcaaggtgttcagctgc
gaatgcggctcctccaagtgcaagtactcgtccgcggccatgacgtcgttgcaggcggac
agcacgccagagagccagcagcagcccagtgcctcccctgacaccagctcgtccgacgct
ccctccagcccctcttaa

DBGET integrated database retrieval system