KEGG   Hippocampus comes (tiger tail seahorse): 109527740Help
Entry
109527740         CDS       T04969                                 

Definition
(RefSeq) uncharacterized protein LOC109527740
  KO
K11429  [histone H4]-N-methyl-L-lysine20 N-methyltransferase [EC:2.1.1.362]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00310  Lysine degradation
hcq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    109527740
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hcq03036]
    109527740
Enzymes [BR:hcq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.362  [histone H4]-N-methyl-L-lysine20 N-methyltransferase
     109527740
Chromosome and associated proteins [BR:hcq03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109527740
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 109527740
NCBI-ProteinID: XP_019745371
LinkDB All DBs
Position
Unknown
AA seq 1863 aa AA seqDB search
MDCCTRMSVKELCDIDDLATSLVLDPLLGFTTHKMNISPAPEVRRWGNLKETLLRFQRTH
DFNATFEALTVGELAGDYFNALGSHRQELLRQHVNRYLNAFLLDSGIQIESCDRYSSETN
GAKITSTRHWFAGERVEVLLGCIAELSPDDSAVLRAGVNDFSVMYSTRKRCAQLWLGPAA
FINHDCKPNCKFVPGEKNGACVEVIRPISPGEEITCYYGASFFGEGNEMCECCTCERKGE
GHFKHKGKQPECEETKDPVGQKYRLRERYLRHQREKGHLNSRPIIPGLHSAIPSRNSFTH
QMRKNALKNRKWNQTNKWRLQNHRLARPCEEQRTLPLLSQCVIRDLRIRVRRHSLDFLLV
CKDPKSKERALLQQLELVKPRTTANVKRFSLGCLQKNRVRVGPNGKSVRGVPLRSSSRTR
STDRVDPDKTSITKKQESKEQENLEPSVCQSAPAPCKKISDKPVVSLKQYLTVRLTRISA
PCEEAPGLSVDNRDIREELRGKMRQIQGLRPLNTQKSQQRQRPPSPITPGHRAAEAPRGV
REMFFKASDQGTLRKRHASKEAVGDSSHLEEGGKNKVIEIQTIAEEGTQPDKDKPEEHKK
KRNATATECKTVSCAKTSQQNNLQGVKSPNPGEVVVLEPLNCTANKPVHNPSNDIIIKQA
KVLLSDFLKNDKASVVKQPHGDSSPLNAREIHAGSHVAARRNVGRWQKIHRRIKTKAELK
SNSTENGLVPTVQNPTQIGEPVATCLNTLPLQSPVSCANMCQTTQHLDAMQSNIPLKKRT
FRSAVEPEQGITAASATSRKEVSGPSSRQELDRHPEKTMKHVKKSKRTRAKVRRVSSRRV
TRQNVGRVLRPRVIETPQSRLRKVDTLKSEREDENSNQETVQLDRNHQTKDEQESDSQKG
TSALEQSDVEETKPELNFRIRFKRRRGKLWEMQSNELGSPIKMEKEEELNNDPFKAIMDS
VSVLSMEMQAAQAHVQASKKSKSRLLRLKKRGERKNASTISELDREESKEKTDGGIPSGS
SLQLDKTQSEKSSLVRQTKTEDGFTRSCCMFDRGSQQKIESNLDFKGVPLPVLKLRRKVK
DIWEVDDKDEGQNQSEVKVDSPVKREVRSPPLVQQIPGLLDLSKVREEPPPLTQKLNCHS
LLQKTEALQMSLSLSPLSLSSPQSETPESAVAANITAERLEACSSSGGRKQWHKMASKCG
PVETPASCLSQSLQQIDNSLSRLSEGLCSSQILEKTTALSGISSSIIQPQSQSPPFPTAD
NILPGEPNFANCCDDLLDFQCLNFEGYDQPQNILNSSPSDLCSLDPPTDPFSSPLSHSPS
DTWPTETPYLGSPSPDNNFTSDDLHFFPAMLTSKNDSVPLDCEAKSASGKIPPQAGFSFS
AFTNPELGGKDHLLSKNPGMRLSREDLKYHSSSVVSKPRLFGTPAAMSQNTLPLVQPTLN
AKPSTSQSRATSNLKTNGPFHRMSISKQPQSFPNCQPTAQRGVAQMKPVLASPMAGKFLN
PQLLAGRNPNPFPGRNPNPFPDNPFNIQDKSPTVIHRVVKIQGGNPSQNLYSVPSKDHVA
AGGHSTSKTFGTKSTENTSEDPQSHHKGTHSAQNLSYFAPSVNPGRSSVYFNKHGSSLHS
SFIRSKPASDKQDDTTLTYKNFSALPRPFFFPSKDGYSFPQEKTSKHDKSTPLSSDKNQP
CYPQQDPFDFSFTSSLSPMSHHSSPQVVHSTPPGTPASVGKSHPAASFSYGPQGPPYVLN
FSGDHSLTLGLRDGPEGYPGLGPTNYTYHCLMEPSGTQGRLVLEPCGSQASNQPSFSMGT
FSGHKGGPDERLKKDAHHQNHPGDHQEIPHYGPTSHSMGPTKPKRVRLVVTDGTVDLDLQ
YSD
NT seq 5592 nt NT seq  +upstreamnt  +downstreamnt
atggactgctgcactagaatgagtgtgaaggagctgtgtgacattgatgacctggccacc
agcctggtgctggaccctctcctgggcttcaccactcataaaatgaatatcagcccagct
ccggaggtgcgtcgctggggcaacctgaaggagacgctgctgcgcttccaacgcacacac
gacttcaacgccactttcgaggcgctgacggtgggcgagctggcaggcgactacttcaac
gctttggggagtcaccggcaggagctactgaggcagcacgtgaaccgctacctcaacgcc
ttccttttggatagcggcatccagattgagtcatgtgaccgctactcctcggagaccaac
ggagccaagattacctctactcgacactggtttgcgggggagcgcgtggaggtccttctg
ggctgcatcgccgagctgagcccggatgacagcgctgtgctgcgggcgggcgtcaacgac
ttcagcgtcatgtactccacgcgcaaacgctgcgctcaactctggcttggacccgccgcc
ttcatcaaccacgactgcaagccaaactgcaagtttgtccccggtgagaagaacggcgct
tgcgtggaggtgattcgacccatctcgcctggggaagagatcacgtgctactacggcgcc
agcttctttggcgagggcaacgaaatgtgcgagtgctgcacctgcgagaggaaaggggaa
ggtcactttaaacacaaagggaagcagccggaatgcgaggaaacaaaagaccccgtgggc
cagaagtaccgccttcgggagcgctaccttcggcaccagcgagagaagggacacttaaac
tcgaggcccattattccaggattacattcagctatcccctctaggaactctttcacccat
cagatgcggaaaaacgcccttaaaaaccgaaagtggaaccagacaaataagtggaggcta
cagaaccacagactcgcgagaccgtgtgaagagcaacgaacgctgccgctcctgtcacag
tgcgtgatccgggacctgaggattagggtgcggcgccactcgctggactttttgcttgtc
tgcaaggatcccaaaagcaaagagagggccctcctgcagcagctggagttggtcaagcca
aggacaaccgccaacgtgaagcgtttctcgctgggttgtcttcagaaaaacagagttcgg
gtaggccccaatgggaaatctgtcagaggggttcccttgaggagctcgtccagaaccaga
agcacggacagggtcgacccggacaaaacctccatcacgaaaaagcaagagagcaaggag
caagagaacttggagcccagcgtctgtcagagtgccccggccccttgtaagaaaatttca
gacaagccagtagtgtcactcaagcaatacctgaccgtccgcctcactcgaatctcagcg
ccttgcgaagaggcaccgggactgagtgttgacaaccgggacataagggaggagctgaga
gggaagatgaggcaaattcagggcctcagaccactgaacacacagaaatcccagcagagg
cagagaccaccatccccgattacgccgggccaccgtgctgccgaagcccctcgaggagtg
cgggaaatgttctttaaggccagtgatcagggaacactacggaagcggcacgcctcaaaa
gaggcagtgggtgactcctctcatctcgaggaaggtgggaagaacaaggttattgaaatc
cagacaatagcggaagagggtacacaaccagacaaagataaaccggaagaacacaaaaag
aaaagaaatgccacagctactgaatgtaaaaccgtgtcctgtgcaaaaacgagccaacag
aataacttgcagggtgttaaatctccaaatccaggtgaggttgttgttttagaaccgtta
aattgcactgcaaacaaaccagtacacaatccaagcaatgacataatcataaagcaggcc
aaggtcctcctgtctgattttttgaagaacgataaagcttcagtagtcaagcaaccacat
ggtgatagttcccccttaaatgcgagagaaatccatgcaggcagccatgtggcagcaaga
cggaatgtcggacggtggcagaaaatccacagaagaataaagactaaagccgagctgaaa
tccaacagcacagaaaacggtttagtccccactgtacagaatccaacccagatcggggaa
ccggtggcaacctgtctcaacacactacctctccagtcgcctgtttcatgtgccaacatg
tgccagaccactcagcaccttgacgccatgcagtccaacatacctctgaagaagcggacg
ttccgcagtgctgtggaaccggagcaaggcataaccgctgcttctgccactagccggaaa
gaggtttccggcccgtcctcaagacaggaactggatcgtcatccagaaaagactatgaaa
catgtcaaaaaaagcaaaaggacgcgggcaaaagtccggagggtgagctccagaagagtc
acgaggcaaaacgtgggcagggtgctaaggcctcgagttattgaaactcctcagagtcga
ctgaggaaagttgacacgcttaaatctgagagggaagatgagaatagcaaccaagagact
gttcagctcgacaggaaccatcagacgaaggatgagcaagagagcgactctcagaaggga
acgtcagctttggaacaaagtgatgttgaggagacaaagccagaacttaacttcaggatt
cgtttcaagcggagaagagggaaattgtgggagatgcagagcaacgaattgggctctcca
atcaaaatggaaaaggaggaggaactcaacaacgatccgtttaaagccatcatggattca
gtgtctgtgttgagcatggagatgcaggcggctcaggcccatgtgcaggccagtaagaag
tccaaaagcagactccttcgcttgaaaaaacggggcgagaggaagaatgcgtccacaatt
tcggagctggacagagaagagagcaaagaaaaaacagacggggggattccttctggttca
agccttcagttggacaaaacccagagtgagaagtcatctttagtccgtcaaacgaaaacg
gaagatgggttcacgagaagctgctgcatgtttgatcgtgggtcgcagcagaaaattgag
tccaatttggatttcaaaggtgttccgctgccggttctcaaattgcgcagaaaggtgaag
gacatctgggaggttgacgacaaggatgaggggcagaaccagtccgaagttaaagtggat
tcaccagtgaagcgagaggtacggagtccccctttagtccagcaaataccaggactgctg
gacttaagcaaggtccgagaggagccaccaccattgactcagaagttgaactgtcactca
ttgctccagaaaactgaagcgctgcagatgtctttgtcgctgtcgccgctttccctgtct
tcccctcaaagcgagaccccagagagcgcagtcgcagcgaacataactgctgagcgactg
gaagcctgcagcagcagtggcggcaggaagcagtggcacaaaatggcgtccaagtgtggc
cctgtggagacacccgcgagctgcctcagtcagtccctccaacagattgacaacagcctc
tccaggctctctgagggtctatgctcatcacagattttggaaaagacaaccgccttgtct
ggaatttccagttccatcatccagcctcagtcccagtctccaccgttcccaactgcggac
aacattctaccgggcgagcccaacttcgcaaactgctgcgacgacctcctggacttccag
tgtctcaacttcgaaggctatgatcagccgcagaacatcctcaactcatcgccctccgat
ctgtgttcactggatccccccacggaccccttcagtagcccgctctcgcacagcccctct
gacacgtggcccactgagacaccctacctcggctccccgagtcccgacaacaacttcacc
agtgacgatctccacttcttccccgctatgctcacatccaagaatgattccgttcctctg
gactgtgaggcaaagagtgcctctggcaaaatcccaccccaagcaggcttcagtttttca
gcgttcaccaatcccgaactggggggaaaggaccaccttctcagtaaaaatcccggaatg
aggctgtccagagaggacttaaaatatcattcctcatccgtggttagcaaacctcgccta
tttggcacacctgctgccatgtctcagaatactcttcctttagtacagcccaccctgaat
gccaaaccaagcaccagccagtcgagagctacatccaacctcaaaacgaatggacccttc
caccgcatgtcaatttccaaacagccccagtcttttccaaactgccagcctactgcgcaa
cgaggcgtcgcccagatgaagcctgtcctggcgtctccgatggccggtaaattcctcaat
cctcaactcttagctggaagaaatcctaaccccttccctggaagaaatcctaaccccttc
cctgacaatcccttcaacatccaggataagtcccccactgtgatccacagggttgttaaa
attcagggcggtaacccaagccagaacttgtacagtgttccctccaaagaccatgtggct
gccggcggccactctacatctaaaacattcggaacaaaatccacagaaaacacaagtgag
gacccgcagagtcatcacaaaggcactcattctgctcagaacctcagctattttgctcct
tccgttaaccccggcaggtccagcgtctatttcaacaaacacggctcatccttacactcg
tcattcatccgaagtaaaccagcctccgacaagcaggacgataccactttgacgtacaaa
aacttctctgcgctgccgagacctttcttcttccccagtaaagacggttattctttccca
caggagaaaacctccaaacatgacaaatccactccgctgagctctgacaagaaccagccg
tgttaccctcagcaggatccatttgattttagcttcacgtcgtcgctttctccaatgtca
catcacagcagtcctcaagtggtccacagtacgccgcccggcacaccggcatcggtcggc
aagagccacccggcagcctccttctcttacggaccacagggacccccttatgtactcaat
ttcagcggtgaccactcgttgacgttgggtctcagggacgggcccgaaggttacccggga
ctcggccccacaaactacacctaccattgcttgatggagccgtctggcactcaggggcgg
ctggtcctggaaccctgcggttctcaggcatccaaccagccctcgttttccatgggtacc
ttctcgggtcacaaagggggtccggacgaacgcctaaagaaggacgctcaccaccagaac
cacccaggcgaccaccaggaaataccacactatggaccaacatctcactccatgggccct
accaaacccaagcgggtgaggctggttgtgacggacggaactgtggacttggacctccaa
tactctgactga

DBGET integrated database retrieval system