KEGG   Hippocampus comes (tiger tail seahorse): 109527996
Entry
109527996         CDS       T04969                                 

Definition
(RefSeq) ribonucleoside-diphosphate reductase subunit M2-like
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00230  Purine metabolism
hcq00240  Pyrimidine metabolism
hcq00480  Glutathione metabolism
hcq00983  Drug metabolism - other enzymes
hcq01100  Metabolic pathways
hcq04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109527996
   00240 Pyrimidine metabolism
    109527996
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109527996
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    109527996
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109527996
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hcq03400]
    109527996
Enzymes [BR:hcq01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     109527996
DNA repair and recombination proteins [BR:hcq03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    109527996
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 109527996
NCBI-ProteinID: XP_019745806
UniProt: A0A3Q2YCL2
LinkDB
Position
Unknown
AA seq 345 aa
MDCLSDDLRGEPNGVKDINTDCQEDEPLLRENPRRFVIFPIQYLEVWKMYKQAQASFWTV
EEVDLSKDLAHWDRLKPEEKHFISHVLAFFAASDGIVNENLVKRFCEEVQVPEARAFYSF
QILMETVHSEMYSILINTYIQDLKERDSLFNAIQLLPCVKRKADWALQWINDSQSTFAER
LVAFAAVEGIFFSGSFAAIYWLKKRGLMPGLTYSNELISRDEGLHCNFACLLYSYLVKKP
SEDRVKDIITEAVSIEKDFLTEALPVELIGINSSLMKQYIQYVADHLLTDLGLAKVYLSE
NPFDFMESISLEGKTNFFEKRVGEYQRFGVMSSMMDCEFTLDADF
NT seq 1038 nt   +upstreamnt  +downstreamnt
atggactgcttgagtgacgaccttcgcggagaaccgaatggcgtaaaagacatcaacacc
gactgccaggaggatgagcctctgctccgagagaaccccagacgcttcgtcattttcccc
atccagtacctcgaagtgtggaagatgtacaagcaggcccaggcttccttttggacagtg
gaagaggtggatctctccaaagacctggcgcactgggaccggctcaaacctgaggagaag
catttcatctcgcatgtcctggccttcttcgctgccagcgatggcattgtgaatgagaac
ttggtaaagagattctgcgaggaggtccaggtccccgaggcacgcgccttctacagcttc
caaatcctgatggagacggtgcactcggagatgtacagcatactcatcaacacctacata
caggatctcaaggaaagagactctctcttcaacgccattcaattgctcccatgtgtcaag
cgtaaggccgactgggcgctccagtggataaatgacagccagtccacctttgccgagcga
cttgtggcttttgcagcggtggagggcatcttcttctccggctccttcgccgccatctac
tggttgaagaaaagaggcctcatgcccggcctcacctactccaacgagctcatcagccgg
gacgagggactgcactgcaactttgcctgtctgctgtacagctacctggtgaagaagcct
tccgaggaccgtgtgaaggacatcatcaccgaggccgttagcatcgagaaggactttctg
actgaggccttaccggtggagctgattggaatcaactcttccctcatgaagcagtacatc
cagtatgtggctgaccacctcctcactgacctgggactagcaaaggtttacttgtccgag
aacccgttcgacttcatggagtctatttcactggaggggaagaccaatttctttgagaag
cgagtgggcgagtaccagagattcggagtcatgtccagcatgatggactgcgagttcact
ctggacgccgacttttga

KEGG   Hippocampus comes (tiger tail seahorse): 109531761
Entry
109531761         CDS       T04969                                 

Definition
(RefSeq) ribonucleoside-diphosphate reductase subunit M2-like
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00230  Purine metabolism
hcq00240  Pyrimidine metabolism
hcq00480  Glutathione metabolism
hcq00983  Drug metabolism - other enzymes
hcq01100  Metabolic pathways
hcq04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109531761
   00240 Pyrimidine metabolism
    109531761
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109531761
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    109531761
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109531761
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hcq03400]
    109531761
Enzymes [BR:hcq01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     109531761
DNA repair and recombination proteins [BR:hcq03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    109531761
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 109531761
NCBI-ProteinID: XP_019751798
LinkDB
Position
Unknown
AA seq 388 aa
MQSVRAPLSASNENKLSADVGRMSLDKENTPPSLNTARILASKTARKIFAETPLKDVKKN
RSREVEPLLKDNPRRFVIFPIQYHDIWRMYKKAEASFWTAEEVDLSKDTQHWEVLKEDEK
FFISHVLAFFAASDGIVNENLVERFTQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYI
KDPKERSLREYLFNAIETMPCVKKKADWALNWIGNKNATYGERVVAFAAVEGIFFSGSFA
AIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVNKPSADTVTSIIRNAVEIEQ
EFLTQALPVKLIGMNCELMKRYIEFVADRLMMELGFSKLFGVENPFDFMENISLEGKTNF
FEKRVGEYQRMGVMATNTDNTFTLDADF
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgcagtctgttcgcgcgcccctttccgcctccaacgagaacaagctgagcgcggacgtc
ggcaggatgtcgctggacaaagaaaacacgcccccgagcctgaacacggcgcgcatcttg
gcgtcgaaaactgcgcgcaaaatcttcgccgagacgccgctcaaagacgtgaagaagaac
aggagcagggaggtggagcctctgctgaaggacaacccgcgccgctttgtcatctttccc
atccaataccacgacatctggcgcatgtacaagaaggccgaggcgtctttctggacagcc
gaggaggtggatctgtccaaggacactcagcactgggaagttctgaaagaagacgagaag
tttttcatctctcacgtgttggccttctttgcggccagcgacggcatcgtcaacgaaaac
ctggtggagcgcttcacgcaggaagttcaggtgacggaggcgcgctgcttctacggcttc
caaatcgccatggagaacatccactcggagatgtacagcctcctcatcgacacctacatc
aaagaccccaaagagcggtcacttagagaatacctgttcaacgccatcgaaacgatgccg
tgtgtcaagaagaaggccgactgggcgctcaactggatcggcaacaagaacgccacctac
ggcgagcgcgtggtggctttcgccgccgtggagggcatcttcttctccggctccttcgcc
gccatcttctggctgaagaaacgcggcctgatgcccggactcaccttctccaacgagctc
atcagcagagacgagggtctccactgcgactttgcctgtctgatgttcaagcacctggtc
aacaagccgtccgcggacacggtgacgtccatcatcaggaacgccgtggagatcgagcag
gagttcctgacgcaggcgctgcccgtcaagctgatcgggatgaactgtgagctgatgaag
cgctacatcgagtttgtggccgaccgcctcatgatggagctcggcttctccaagctgttc
ggcgtggagaacccgttcgacttcatggagaacatctcgctggagggcaagaccaacttc
ttcgagaagcgcgtcggcgagtaccagaggatgggcgtcatggccaccaacaccgacaac
accttcacgctggacgccgacttttga

KEGG   Hippocampus comes (tiger tail seahorse): 109531764
Entry
109531764         CDS       T04969                                 

Definition
(RefSeq) ribonucleoside-diphosphate reductase subunit M2-like isoform X1
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00230  Purine metabolism
hcq00240  Pyrimidine metabolism
hcq00480  Glutathione metabolism
hcq00983  Drug metabolism - other enzymes
hcq01100  Metabolic pathways
hcq04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109531764
   00240 Pyrimidine metabolism
    109531764
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109531764
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    109531764
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109531764
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hcq03400]
    109531764
Enzymes [BR:hcq01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     109531764
DNA repair and recombination proteins [BR:hcq03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    109531764
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 109531764
NCBI-ProteinID: XP_019751801
LinkDB
Position
Unknown
AA seq 385 aa
MQSVRSPLSASNENKLSADVGRMSLDKENTPPSLNTARILASKTARKIFAETPLKDVKKN
RSREVEPLLKDNPRRFVIFPIQYHDIWRMYKKAEASFWTAEEVDLSKDTQHWEVLKEDEK
FFISHVLAFFAASDGIVNENLVERFTQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYI
KDPKEREYLFNAIETMPCVKKKADWALNWIGNKNATYGERVVAFAAVEGIFFSGSFAAIF
WLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVNKPSADTVTSIIRNAVEIEQEFL
TQALPVKLIGMNCELMKRYIEFVADRLMMELGFSKLFGVENPFDFMENISLEGKTNFFEK
RVGEYQRMGVMATNTDNTFTLDADF
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgcagtccgttcgctcgcccctttccgcctccaacgagaacaagctgagcgcggacgtc
ggcaggatgtcgctggacaaagaaaacacgcccccgagcctgaacacggcgcgcatcttg
gcgtcgaaaactgcgcgcaaaatcttcgccgagacgccgctcaaagacgtgaagaagaac
aggagcagggaggtggagcctctgctgaaggacaacccgcgccgctttgtcatctttccc
atccaataccacgacatctggcgcatgtacaagaaggccgaggcgtcattctggaccgcc
gaggaggtggatctgtccaaggacactcagcactgggaagttctgaaagaagacgagaag
tttttcatctctcacgtgttggccttctttgcggccagcgacggcatcgtcaacgaaaac
ctggtggagcgcttcacgcaggaagttcaggtgacggaggcgcgctgcttctacggcttc
caaatcgccatggagaacatccactcggagatgtacagcctcctcatcgacacctacatc
aaagaccccaaagagagagaatacctgttcaacgccatcgaaacgatgccgtgtgtcaag
aagaaggccgactgggcgctcaactggatcggcaacaagaacgccacctacggcgagcgc
gtggtggctttcgccgccgtggagggcatcttcttctccggctccttcgccgccatcttc
tggctgaagaaacgcggcctgatgcccggactcaccttctccaacgagctcatcagcaga
gacgagggtctccactgcgactttgcctgtctgatgttcaagcacctggtcaacaagccg
tccgcggacacggtgacgtccatcatcaggaacgccgtggagatcgagcaggagttcctg
acgcaggcgctgcccgtcaagctgatcgggatgaactgtgagctgatgaagcgctacatc
gagtttgtggccgaccgcctcatgatggagctcggcttctccaagctgttcggcgtggag
aacccgttcgacttcatggagaacatctcgctggagggcaagaccaacttcttcgagaag
cgcgtcggcgagtaccagaggatgggcgtcatggccaccaacaccgacaacaccttcacg
ctggacgcagacttctga

DBGET integrated database retrieval system