KEGG   Hippocampus comes (tiger tail seahorse): 109528351
Entry
109528351         CDS       T04969                                 

Definition
(RefSeq) insulin-like growth factor I
  KO
K05459  insulin-like growth factor 1
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04010  MAPK signaling pathway
hcq04068  FoxO signaling pathway
hcq04114  Oocyte meiosis
hcq04115  p53 signaling pathway
hcq04150  mTOR signaling pathway
hcq04510  Focal adhesion
hcq04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109528351
   04068 FoxO signaling pathway
    109528351
   04150 mTOR signaling pathway
    109528351
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109528351
   04115 p53 signaling pathway
    109528351
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109528351
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    109528351
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hcq04052]
    109528351
Cytokines and growth factors [BR:hcq04052]
 Growth factors
  Growth factors (RTK binding)
   109528351
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 109528351
NCBI-ProteinID: XP_019746350
LinkDB
Position
Unknown
AA seq 187 aa
MNSSHCSLGRPLPLKVLCMFCSTMCLVSGPLCCEGAKLRCGSELLNDLLFVCGDRGLYLG
KGTWSGYGSRPRGKGIVDKCCRSNGCDLHHLEMYCAKAKKQQPTTAWPSTSTSIESLTTQ
QTEVAYQFQAVFQKRLLQHLGPPDSPERETYRNKIKASSRRKMTGQHTTTREAPLMATTR
TDILLTG
NT seq 564 nt   +upstreamnt  +downstreamnt
atgaactcctcacattgttctttagggagaccactgccattgaaggtgttgtgcatgttc
tgctcgaccatgtgcctggtcagcgggcctctttgctgcgagggagccaagcttcgttgc
ggctcggaactcctcaatgacctcctgtttgtgtgtggtgatcgtggactctacttaggg
aaagggacatggtctggttatggttctcggcccagagggaaggggattgtggacaaatgc
tgccgctcaaatggctgtgacctgcatcatttggagatgtattgtgctaaggcaaagaag
caacagccgactacagcatggccaagtacaagtacaagtattgaaagcctcaccacacaa
caaacggaagtggcttatcagttccaagcagtttttcagaaaagacttttacagcacctg
ggaccacccgacagtccagagcgagagacttataggaacaaaataaaagcctcatcacgc
aggaagatgaccggacagcacacaacgacaagggaggcccccttgatggccacgacaagg
acagacatccttttaaccggctga

KEGG   Hippocampus comes (tiger tail seahorse): 109530129
Entry
109530129         CDS       T04969                                 

Gene name
igf1
Definition
(RefSeq) LOW QUALITY PROTEIN: insulin-like growth factor I
  KO
K05459  insulin-like growth factor 1
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04010  MAPK signaling pathway
hcq04068  FoxO signaling pathway
hcq04114  Oocyte meiosis
hcq04115  p53 signaling pathway
hcq04150  mTOR signaling pathway
hcq04510  Focal adhesion
hcq04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109530129 (igf1)
   04068 FoxO signaling pathway
    109530129 (igf1)
   04150 mTOR signaling pathway
    109530129 (igf1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109530129 (igf1)
   04115 p53 signaling pathway
    109530129 (igf1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109530129 (igf1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    109530129 (igf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hcq04052]
    109530129 (igf1)
Cytokines and growth factors [BR:hcq04052]
 Growth factors
  Growth factors (RTK binding)
   109530129 (igf1)
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 109530129
NCBI-ProteinID: XP_019749267
LinkDB
Position
Unknown
AA seq 149 aa
MSCALSSLRWHLWDVLKNAMCWMSRSHTLSLLLCVLSLTPAASGARPETLCGAELVDTLQ
FVCGERGFYFSKPTGYGPNARRSRGIVDECCFQSCELRRLEMYCAPAKTSKAARXTDKAK
NKKKPLPGPSHSAFKVRSLAPPFRRLTPA
NT seq 450 nt   +upstreamnt  +downstreamnt
atgtcctgcgctctttcctccctccggtggcatttatgggacgtcctcaagaatgcgatg
tgctggatgtcccgtagccacaccctctcactactgctgtgcgtccttagcctgactccg
gcggcctcaggggcgcggccagagacgctgtgcggggcggagctggtcgacacgctgcag
tttgtgtgcggagagcggggcttttatttcagtaagccgaccggctacggccccaacgcc
cggcggtcgcggggcatcgtggacgagtgctgcttccagagctgcgagctgcggcggctg
gagatgtactgcgcgcccgccaagaccagcaaggccgcccgctagacggacaaggcaaaa
aacaagaagaaacctttacccggacccagtcactcagcctttaaggtacgctctttggct
cctcccttccgccgtttgacacccgcgtga

DBGET integrated database retrieval system