KEGG   Hippocampus comes (tiger tail seahorse): 109528457
Entry
109528457         CDS       T04969                                 

Definition
(RefSeq) cellular tumor antigen p53-like isoform X1
  KO
K04451  tumor protein p53
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04010  MAPK signaling pathway
hcq04110  Cell cycle
hcq04115  p53 signaling pathway
hcq04137  Mitophagy - animal
hcq04210  Apoptosis
hcq04216  Ferroptosis
hcq04218  Cellular senescence
hcq04310  Wnt signaling pathway
hcq05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109528457
   04310 Wnt signaling pathway
    109528457
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    109528457
  09143 Cell growth and death
   04110 Cell cycle
    109528457
   04210 Apoptosis
    109528457
   04216 Ferroptosis
    109528457
   04115 p53 signaling pathway
    109528457
   04218 Cellular senescence
    109528457
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109528457
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hcq03000]
    109528457
   03036 Chromosome and associated proteins [BR:hcq03036]
    109528457
   03400 DNA repair and recombination proteins [BR:hcq03400]
    109528457
Transcription factors [BR:hcq03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    109528457
Chromosome and associated proteins [BR:hcq03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     109528457
DNA repair and recombination proteins [BR:hcq03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    109528457
SSDB
Motif
Pfam: P53 P53_tetramer
Other DBs
NCBI-GeneID: 109528457
NCBI-ProteinID: XP_019746643
LinkDB
Position
Unknown
AA seq 385 aa
MNCAKKISKMEPSLGDLSLSQEFLNSQGSFSDFWQNINVQDLLSTPSMTGPLDDNDPSSS
NQLPELQVQFDDEIFNISAEPLATEGVPPPTPTVLVTTDHPGEYDFLLRFQKSGTAKSVT
STFSVMLNKLYCQLAKTTPVEILVSKEPPAGAILKAMAVYKKTEHAADVVRRCPHHQNQD
AAEHRSHLIRMEGSQRVQYFEDVFTKRQSVTVPYETPQLGSEMTTILLSFMCNSSCMGGM
NRRPILAILTLETPEGVILGRRCFEVRICACPGRDRKSEEENHTQIINGTKQTKKRKSTP
ATTSAPVKRSVPTSTTSSTEGDDEEIFYLPIRGRDRYELFKRFYEGLEQDKKGKNKSNAA
VDQQHVPMPISGKRLMLKGERSDTE
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgaactgtgcaaaaaagatatcaaagatggagccaagcctgggggacttgtctctgagc
caggagttcctgaatagtcagggatcattcagtgatttctggcaaaacataaatgtgcag
gatttgctttctacaccaagcatgaccggtcctcttgatgataatgacccatccagcagc
aaccagctccccgagttgcaagtacaatttgacgatgaaatcttcaacatatcagctgag
ccgctcgccactgaaggcgtcccgccaccgacccccactgtgctggtcaccacagaccat
cccggggagtacgacttcctgctccgtttccagaagtctggaactgccaagtcagttaca
tccactttttctgtgatgctcaacaagctgtactgccagctggctaagaccaccccggtg
gaaattctggtgagcaaagagccgccggcgggcgccatcctcaaagccatggcggtctac
aagaaaacggagcacgcggccgacgtggtacgccgttgcccccaccaccagaaccaggat
gccgcagagcaccgcagccatctgatccgaatggagggcagccagagggtgcagtatttt
gaggacgttttcaccaagaggcagagcgtgaccgttccctacgagaccccccagttgggc
tctgagatgacaaccatcctactctccttcatgtgcaacagctcctgcatgggagggatg
aatcgcaggcccatcctcgcaattttgactctggagacccccgagggcgtgattttgggt
cgaaggtgttttgaggtgcgcatttgtgcgtgtcccggtcgggatcgcaaatccgaagag
gagaaccacacccagatcataaatggcaccaagcaaactaagaaacgaaagagcacccca
gccacgaccagcgcccccgttaagaggtccgttcccacctccaccacctccagcacggag
ggagatgacgaagagattttttatttgcccattcgagggcgtgaccgttatgagctgttt
aaacggttctacgaaggcctggaacaggacaagaaaggaaaaaacaagtcaaatgcggcg
gtggaccagcagcacgtgccgatgccaatcagtgggaagcgactcatgctgaaaggagaa
cgcagtgacactgaatga

DBGET integrated database retrieval system