KEGG   Hippocampus comes (tiger tail seahorse): 109528595
Entry
109528595         CDS       T04969                                 

Gene name
ikbkg
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04010  MAPK signaling pathway
hcq04210  Apoptosis
hcq04620  Toll-like receptor signaling pathway
hcq04621  NOD-like receptor signaling pathway
hcq04622  RIG-I-like receptor signaling pathway
hcq04623  Cytosolic DNA-sensing pathway
hcq04625  C-type lectin receptor signaling pathway
hcq04920  Adipocytokine signaling pathway
hcq05132  Salmonella infection
hcq05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109528595 (ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109528595 (ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109528595 (ikbkg)
   04621 NOD-like receptor signaling pathway
    109528595 (ikbkg)
   04622 RIG-I-like receptor signaling pathway
    109528595 (ikbkg)
   04623 Cytosolic DNA-sensing pathway
    109528595 (ikbkg)
   04625 C-type lectin receptor signaling pathway
    109528595 (ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109528595 (ikbkg)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109528595 (ikbkg)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109528595 (ikbkg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hcq01001]
    109528595 (ikbkg)
Protein kinases [BR:hcq01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   109528595 (ikbkg)
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10 Nucleoplasmin
Other DBs
NCBI-GeneID: 109528595
NCBI-ProteinID: XP_019746968
UniProt: A0A3Q2Y2S0
LinkDB
Position
Unknown
AA seq 610 aa
MVQPQPDGPLQWDMSGEDSGGALRVPPELAANEVVTRLLGDNQQLREALRRSNLALRQRC
EEMEGWQRKTREDREFLSCRFQEARALVERLALENHSLQGLVNGPASSSNHCCSSSQTES
SFPTKNGPLDAPQIFDQREKMTAEEADQHTQATPPRSLGDASVCSSVSSALPTPPTSLTE
VSGGSVGRENGQPVQYANDFLQVKSHKEKLEEGMRDLKKKNEELERQRDEGEKERERMRR
CIDQLAAKLAQAQASSATEEAGQHRSEAQHSSDCSSLAKLTEQLQATQGRYRELEEKLDY
LQKSSAQRDRTEGLLKQKDKDCEALKAQATSLLAELNERQSCLNKSEQERKMLEDKLCSK
VKALQVAEQELEQQRNQHHVNMDKLMLQIQSLEQALKTERNVVAVEKKKLTQLQHAYTSL
VRSYDSILKNEGGDLCSRLEEAERALALKQDLIDKLKEEVEQQKGSLETVPVLTAQAEIY
KADFLAEREAREKLNQKKEELQDQLNHALAEIDRHKQEATSRARMEQMKLRHQEDFPTRV
PHIPPPQGGFSAGAFNTAPPPSLYRNPGLVQPSDQGAAGVEDLPDLCCPKCQYHAPDMDT
LQIHVMDCIQ
NT seq 1833 nt   +upstreamnt  +downstreamnt
atggtgcagccccaacctgatggcccactgcagtgggacatgtcaggagaggatagtgga
ggggccctcagggtcccacctgagctggcagccaatgaagtggtcaccaggttgcttgga
gacaatcagcagctcagagaagccttgcggcgtagtaaccttgccttgcgtcagcgctgt
gaagagatggagggttggcaaagaaagacgagggaggatagggaatttctcagttgtcgt
ttccaagaggccagggctctggtggaaaggctggcactggagaaccactctttacaaggc
ctggtgaatggaccggcctcctcatccaaccactgctgtagctccagccagactgaaagc
tcttttccaacaaagaatggcccacttgatgcaccacagatatttgatcaacgggaaaag
atgacagcggaggaagcagatcaacacacacaggcaactccccctcgtagcttgggtgat
gcaagtgtatgtagctccgtgagtagtgccctcccaaccccccctacctcccttacagag
gtatcagggggttcagtgggcagggaaaatggccagcctgtccaatatgcaaatgacttc
ctgcaagtgaagagccacaaagaaaagctggaggaaggcatgcgcgatctgaagaagaaa
aacgaagagctggagaggcagcgggacgagggcgaaaaggaaagagagcgaatgcgtcgc
tgcattgatcagctggcggccaaattggcccaagcacaggcaagcagcgccactgaggag
gccggccaacatcgcagtgaagcccagcactcctctgactgctctagcctggctaaactc
acagagcagcttcaggccacgcagggcaggtatcgtgagctagaagagaagcttgactac
ctgcagaagagttctgctcaacgtgacagaaccgagggtctgctgaagcaaaaggacaag
gactgtgaggctctcaaagctcaggcaacatctctcttagcagaactgaatgagaggcag
agctgcctgaacaaaagcgagcaagaacgcaaaatgctggaggacaagttgtgtagtaag
gtgaaagccctgcaggtggcagagcaagaactggagcaacagaggaatcagcatcatgtg
aacatggacaagcttatgttgcagattcagagcttggagcaagccctcaagacagagaga
aatgttgtcgctgtggaaaagaaaaaacttacacagcttcagcatgcttacacgagtctt
gttagaagctatgattctatcctcaaaaatgagggaggagatctgtgcagccgactggag
gaggctgagagagcgctggccctcaagcaggacctgattgacaaactaaaggaggaggtc
gagcagcaaaaaggctcactggagacggttcctgtccttactgcgcaggctgagatctac
aaagcagatttccttgcagaacgagaagcaagagaaaagctaaaccagaagaaagaagag
ctgcaggatcagctgaatcatgctttggcggagatcgacaggcacaaacaggaagccaca
tcccgggcgcgtatggagcagatgaagctgaggcatcaggaggactttccaacacgggtt
ccacacattccgcctccacagggtggattttctgccggagctttcaacacggcaccccct
ccatcattgtaccgcaatccaggattggtgcagcctagtgatcaaggagcagcaggagtt
gaggatttgccagacttatgttgtcccaagtgccagtaccacgctccagacatggacaca
ctgcaaatccacgttatggactgcatacagtaa

DBGET integrated database retrieval system