KEGG   Hippocampus comes (tiger tail seahorse): 109528779
Entry
109528779         CDS       T04969                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 6-like isoform X1
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04010  MAPK signaling pathway
hcq04060  Cytokine-cytokine receptor interaction
hcq04115  p53 signaling pathway
hcq04210  Apoptosis
hcq04217  Necroptosis
hcq05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109528779
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109528779
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109528779
   04217 Necroptosis
    109528779
   04115 p53 signaling pathway
    109528779
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109528779
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hcq04050]
    109528779
   04090 CD molecules [BR:hcq04090]
    109528779
Cytokine receptors [BR:hcq04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   109528779
CD molecules [BR:hcq04090]
 Proteins
  109528779
SSDB
Motif
Pfam: TNFR_c6 Death EphA2_TM DUF5325 DUF1180
Other DBs
NCBI-GeneID: 109528779
NCBI-ProteinID: XP_019747297
LinkDB
Position
Unknown
AA seq 330 aa
MRTSYSFFASSLTRFSILVLFGSHLSLGVDASSRLQKKREVLCADGLYQHDSITCCLCAI
GQRLKKHCTAASPQDTQCELCEPGLYNSHPNQDSNCKRCTSCSHQNANLEVESACTRARD
TKCRCKAHHYCISANDQDCKLCSSCTECGLEGVKVACTATNDTVCNDKLKVRSHVWIAVA
VACAAVTIIVIGVCFRRNRKQRRNNQQSSNNPATVRLEMEPINIPYTDPSRHLPAIAKDL
GWKTMVEVAMRSGMNPVRIDGCKIDNPHDSEERTLQLLRMWTQEQGMDAMKNLIQILHDI
KQKGKAQKVKTTCCSLQGGEQQSLQQQLNP
NT seq 993 nt   +upstreamnt  +downstreamnt
atgaggacgtcttattcctttttcgcttcgtcgcttactcgtttttccatccttgttttg
ttcggctcccatttgtcgttgggcgtcgacgcgtcatcgcggctgcaaaagaaaagagaa
gtcctgtgtgcggatggactgtaccaacatgactcaataacctgttgcctgtgtgccatt
ggtcagcgtctgaagaagcactgcactgctgccagtccacaagatacgcaatgtgagctg
tgtgagccaggcttgtacaacagccacccaaaccaggacagcaactgcaagcgctgcacc
tcctgctcacatcaaaatgccaatctggaggtggagtcggcctgtacccgagcacgcgac
accaagtgccggtgcaaagcgcaccactattgcattagcgccaatgatcaagactgtaaa
ctctgcagttcttgtacagagtgcggcctggaaggcgtcaaagtagcctgcacagccacc
aatgacactgtatgcaatgacaaattaaaagtgagaagtcatgtctggatagcagtcgct
gtagcttgtgcagctgtcacaataattgtgattggtgtgtgctttcgaaggaaccgcaaa
cagcgaaggaacaaccaacagagctcgaacaatccagcgacggtgcggttggagatggag
ccaattaacataccgtatacagacccttcgcggcacctgcccgcgatcgcaaaagacctc
gggtggaaaactatggtcgaagtggcaatgcggagcgggatgaacccggtcagaattgac
ggctgcaaaatcgacaacccgcatgacagtgaggagcgcacgctgcagctactgaggatg
tggacacaggagcaaggcatggacgccatgaaaaacttgatccaaatcctgcacgacatc
aagcagaaaggcaaagcgcaaaaggtgaagacaacttgctgctctttacaaggaggtgaa
cagcaaagtttacaacaacagttgaacccataa

DBGET integrated database retrieval system