KEGG   Hippocampus comes (tiger tail seahorse): 109528780Help
Entry
109528780         CDS       T04969                                 

Gene name
gsto1
Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00480  Glutathione metabolism
hcq00980  Metabolism of xenobiotics by cytochrome P450
hcq00982  Drug metabolism - cytochrome P450
hcq00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109528780 (gsto1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    109528780 (gsto1)
   00982 Drug metabolism - cytochrome P450
    109528780 (gsto1)
   00983 Drug metabolism - other enzymes
    109528780 (gsto1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hcq02000]
    109528780 (gsto1)
Enzymes [BR:hcq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     109528780 (gsto1)
Transporters [BR:hcq02000]
 Other Transporters
  Pores ion channels [TC:1]
   109528780 (gsto1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_3 Glutaredoxin GST_C_5
Motif
Other DBs
NCBI-GeneID: 109528780
NCBI-ProteinID: XP_019747299
LinkDB All DBs
Position
Unknown
AA seq 239 aa AA seqDB search
MASAKCVAKGCAAPGPVPAGSIRLYSMRFCPFAQRTRLVLNGKDIKHDIVNINLRDKPDW
FLEKNPLGQVPTLETSAGEVIYESPITCEYLDEMYPEKKLLPEKPFGKAEHKMLLEKFSK
LTPLTYKIPMGRLKGEDVSGLHTELTQKFRELNEHLAKKKTKFFGGDSVNMTDYMIWPWF
ERLEPLELKDCLDDAPELRNWVKLMYEDPVVKVSGHSVDVYKAFYKTYLEGKPNFDYGL
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtgccaagtgcgtcgctaaagggtgtgctgcgcccggacccgtgccagccggc
tccatcagactatacagcatgaggttctgcccttttgctcagaggacccgactggtgctg
aatggaaaagacatcaagcatgatattgtcaacatcaacctgagagacaaacccgattgg
ttcctggagaaaaatcctttgggccaagtgcccacactggagacgtcggcgggggaggtc
atttacgagtctcccatcacctgcgagtacctggacgagatgtatcctgagaagaagctg
cttcccgaaaaaccatttggaaaagccgagcacaagatgttactggagaaattttccaag
ttaacaccattaacctacaagattccaatgggcagactgaaaggcgaggatgtctccgga
cttcatacggaactgacgcagaagttccgagaattaaacgagcacctggcaaagaagaag
acaaagttctttggtggagattccgtcaacatgaccgattacatgatatggccgtggttt
gagaggctggagcccctcgagttgaaggactgcttggacgatgcgcctgagttgaggaac
tgggtgaagctcatgtacgaagaccccgtcgtcaaagttagcgggcacagtgtggacgtc
tacaaggccttctacaagacctacctggagggcaaacccaattttgactacggcctgtag

DBGET integrated database retrieval system