KEGG   Hippocampus comes (tiger tail seahorse): 109529490Help
Entry
109529490         CDS       T04969                                 

Gene name
lig1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq03030  DNA replication
hcq03410  Base excision repair
hcq03420  Nucleotide excision repair
hcq03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    109529490 (lig1)
   03410 Base excision repair
    109529490 (lig1)
   03420 Nucleotide excision repair
    109529490 (lig1)
   03430 Mismatch repair
    109529490 (lig1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hcq03032]
    109529490 (lig1)
   03400 DNA repair and recombination proteins [BR:hcq03400]
    109529490 (lig1)
Enzymes [BR:hcq01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     109529490 (lig1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     109529490 (lig1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     109529490 (lig1)
DNA replication proteins [BR:hcq03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    109529490 (lig1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     109529490 (lig1)
DNA repair and recombination proteins [BR:hcq03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     109529490 (lig1)
   NER (nucleotide excision repair)
    Other NER factors
     109529490 (lig1)
   MMR (mismatch exicision repair)
    Other MMR factors
     109529490 (lig1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 109529490
NCBI-ProteinID: XP_019748428
LinkDB All DBs
Position
Unknown
AA seq 928 aa AA seqDB search
MQRSIASFFQSKVKDKDVQKTASDEQVKKAARSPLKAQNGAHQEDSPVKKVAKRTRRILD
SDDDDDEEVVNVGKQQVKEDVFKAVSTTMSLPPPPPAPAIPSTPTSSMSPSTPTSVSSSE
GISKRKTARKMFPKRKLDDSGSDSQKEDEANTKIPAADDSQRKKRARVDDGDRDEFAEEE
RDDSEAATEQVRTPDKDRENAEEIEKKLEEEEEDKNDDKAAKEEAKKAHISSFFAPRKAA
VKTEKKSEREKKTGMTTSTSSMKEDSKDAKSESTETDYNPSRPNYHPLEHACWKEGQKVP
YLALARTFEKIEEDSGRLRNIETLANLFRSVLLLSPDDLLCCVYLCLNQLGPAYLGVELG
IGETVLMKAVAQATGRQLDKIKAEAQERGDLGLVAESSRSNQRTMFRPASLTVGGVFKKL
KEIASMSGNSAMNKKIDIIKGLFVACRFSEARYIVRSLAGKLRIGLAEQSVLSALSQAVC
LTTPQKGTSPAVMDAGKGMTAESRRAWIEEKNLILKQTYCEMPNYDILIPVLLKEGIDKL
PDHCKLTPGVPLRPMLAHPTKGVGEVMKRFDEAAFTCEYKYDGERAQIHILESGEVRIFS
RNQEDNTTKYPDVISRIPKVKKDSVVSCVLDSEAVAWDREKKQIQPFQVLTTRKRKDVDA
ADIKVQVCVYAFDLLYLNGESLVRQPLCRRRELLRESFAEAEGEFVFARFIDSDNTETIA
EFLEQSVRDSCEGLMVKTLEKDATYEIAKRSHNWLKLKKDYLEGVGDTVDLCVIGAYLGK
GKRTGTYGGFLLACYDEDNEEFQSVCKIGTGFKDEDLEQHHKFLKEHILPKPRPYYRVDQ
SAEPDVWLDAVQVWEVKCADLSLSPVYKAAMGMVDPEKGISLRFPRFLRIRDDKKPEDAT
SGAQIADLYKKQQQILNQGDKADTEDYF
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcagcatcgcatccttttttcaatcaaaggtgaaggacaaagatgtacagaag
acagccagtgacgagcaagtgaaaaaggctgccagaagcccactcaaggcccaaaacggg
gcccaccaagaggactcgcccgtcaagaaggttgccaaacgcactcggcgcattttggac
agcgacgacgacgatgatgaagaagtcgtgaatgttggcaaacaacaggtcaaagaggac
gtcttcaaggcagtgtcaacaaccatgtcgcttccgccgcctcccccggcccctgccatt
ccttccacacccacctcctccatgtcccctagcacccccacctctgtctcgtcttctgaa
ggcatcagcaaacgcaagacggcgaggaagatgttccccaagaggaagctggacgacagc
ggcagtgacagtcaaaaggaggacgaggccaacaccaagattccggcggcggacgatagt
cagcggaaaaaacgagcccgtgtggacgatggcgacagagacgagtttgctgaggaagaa
agagacgacagcgaggcagcgacggagcaagtgaggacgccggataaagacagagagaat
gcggaagagattgaaaaaaagctggaggaagaggaggaagacaagaatgacgacaaggcc
gcaaaagaggaagccaagaaagctcatatcagcagcttctttgctcccagaaaggctgca
gtgaagacggagaaaaagagcgaaagagagaagaagacaggaatgacgacttcgacttcc
tccatgaaggaggacagcaaagatgccaaaagtgagtcgacggaaacggactacaaccca
tccagacccaactaccacccactcgagcatgcctgctggaaggagggacaaaaggtgcct
tacctggcgctggctcgcacctttgagaagatcgaagaggactctggcagactgagaaac
atcgagactctggccaacctgttccgctcagtgctgctgctttctccagacgacctgctg
tgctgcgtctacttgtgtctaaaccagttgggacctgcctacctcggcgtggagcttggc
attggagagacggtgctgatgaaagctgttgcgcaggccacggggcgacagctggacaag
atcaaggcagaggctcaggagcgcggggaccttggtctggtggccgagagctcccgcagc
aaccagcgcaccatgttcaggccggccagcctgacggtgggcggcgtcttcaagaagctc
aaggagatcgcaagcatgagcggcaattcggccatgaataagaagatcgacatcatcaaa
ggactctttgtggcctgccgcttctccgaggcccgctacatcgtcaggtcattagccggg
aagctgcggatcggattggccgagcagagtgtcctgtcggcgttaagtcaagccgtgtgc
ctcactacaccccagaaaggtacctctcctgccgtgatggacgccgggaaagggatgact
gccgagagcaggcgtgcttggatcgaagagaagaatcttattttgaaacagacttactgt
gagatgcccaactacgacatcctcatccccgttcttcttaaagaaggcatcgacaagctg
cccgatcactgcaaactcaccccaggcgtacccctgaggcccatgctggcgcaccccact
aagggagtcggggaggtgatgaaacgcttcgacgaggcggcgttcacctgcgagtacaaa
tatgatggcgagcgcgcgcaaattcacatcctggagagcggcgaggttcggatattcagc
cgcaaccaggaggacaacaccaccaagtaccctgacgtcatctctcgtatccccaaggtg
aagaaagactcggtggtctcctgcgtgctggattctgaggcggtggcgtgggatcgcgag
aagaaacagatccagccgttccaggtcctcaccacacgcaagagaaaggatgtggatgca
gccgacatcaaagtccaagtgtgtgtgtacgcctttgatctcctctacctcaatggagag
tctcttgtgcgacagccactgtgtcggcgtcgggagctcctgcgagagtcctttgccgaa
gcggaaggagagtttgtatttgcccgattcatcgactcggacaacacggagaccatcgca
gagttcctggagcagtctgtccgagactcgtgcgaaggcttgatggtgaagactctggag
aaggacgccacctatgaaatcgccaaacgctcccataactggctcaagttgaagaaggac
tacctggagggcgtgggggacacggtggacctgtgcgttatcggcgcctaccttggcaaa
ggcaagaggacggggacatatggcggcttcctgctagcctgctacgacgaagacaacgag
gagttccagtcggtctgcaagatcgggactggcttcaaggatgaagacctggagcagcac
cacaagttcttgaaggaacacatcttgcccaagccccgcccctactaccgcgtggaccaa
tcggccgagcccgacgtgtggctggatgctgtgcaggtttgggaggtcaagtgtgccgac
ctgtcgctgtcgcccgtgtacaaggccgccatgggaatggtggatccagagaaaggaatc
tccctgcgtttccctcgcttccttcgcatccgagacgacaagaagcccgaggacgccacg
agcggcgctcagatcgccgacctgtacaagaagcagcagcagatcctgaatcagggagac
aaagccgacacggaggactacttttga

DBGET integrated database retrieval system