KEGG   Hippocampus comes (tiger tail seahorse): 109529490Help
Entry
109529490         CDS       T04969                                 

Gene name
lig1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq03030  DNA replication
hcq03410  Base excision repair
hcq03420  Nucleotide excision repair
hcq03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:hcq00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    109529490 (lig1)
   03410 Base excision repair
    109529490 (lig1)
   03420 Nucleotide excision repair
    109529490 (lig1)
   03430 Mismatch repair
    109529490 (lig1)
Enzymes [BR:hcq01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     109529490 (lig1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     109529490 (lig1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     109529490 (lig1)
DNA replication proteins [BR:hcq03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    109529490 (lig1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     109529490 (lig1)
DNA repair and recombination proteins [BR:hcq03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     109529490 (lig1)
   NER (nucleotide excision repair)
    Other NER factors
     109529490 (lig1)
   MMR (mismatch exicision repair)
    Other MMR factors
     109529490 (lig1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 109529490
NCBI-ProteinID: XP_019748428
LinkDB All DBs
Position
Unknown
AA seq 928 aa AA seqDB search
MQRSIASFFQSKVKDKDVQKTASDEQVKKAARSPLKAQNGAHQEDSPVKKVAKRTRRILD
SDDDDDEEVVNVGKQQVKEDVFKAVSTTMSLPPPPPAPAIPSTPTSSMSPSTPTSVSSSE
GISKRKTARKMFPKRKLDDSGSDSQKEDEANTKIPAADDSQRKKRARVDDGDRDEFAEEE
RDDSEAATEQVRTPDKDRENAEEIEKKLEEEEEDKNDDKAAKEEAKKAHISSFFAPRKAA
VKTEKKSEREKKTGMTTSTSSMKEDSKDAKSESTETDYNPSRPNYHPLEHACWKEGQKVP
YLALARTFEKIEEDSGRLRNIETLANLFRSVLLLSPDDLLCCVYLCLNQLGPAYLGVELG
IGETVLMKAVAQATGRQLDKIKAEAQERGDLGLVAESSRSNQRTMFRPASLTVGGVFKKL
KEIASMSGNSAMNKKIDIIKGLFVACRFSEARYIVRSLAGKLRIGLAEQSVLSALSQAVC
LTTPQKGTSPAVMDAGKGMTAESRRAWIEEKNLILKQTYCEMPNYDILIPVLLKEGIDKL
PDHCKLTPGVPLRPMLAHPTKGVGEVMKRFDEAAFTCEYKYDGERAQIHILESGEVRIFS
RNQEDNTTKYPDVISRIPKVKKDSVVSCVLDSEAVAWDREKKQIQPFQVLTTRKRKDVDA
ADIKVQVCVYAFDLLYLNGESLVRQPLCRRRELLRESFAEAEGEFVFARFIDSDNTETIA
EFLEQSVRDSCEGLMVKTLEKDATYEIAKRSHNWLKLKKDYLEGVGDTVDLCVIGAYLGK
GKRTGTYGGFLLACYDEDNEEFQSVCKIGTGFKDEDLEQHHKFLKEHILPKPRPYYRVDQ
SAEPDVWLDAVQVWEVKCADLSLSPVYKAAMGMVDPEKGISLRFPRFLRIRDDKKPEDAT
SGAQIADLYKKQQQILNQGDKADTEDYF
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcagcatcgcatccttttttcaatcaaaggtgaaggacaaagatgtacagaag
acagccagtgacgagcaagtgaaaaaggctgccagaagcccactcaaggcccaaaacggg
gcccaccaagaggactcgcccgtcaagaaggttgccaaacgcactcggcgcattttggac
agcgacgacgacgatgatgaagaagtcgtgaatgttggcaaacaacaggtcaaagaggac
gtcttcaaggcagtgtcaacaaccatgtcgcttccgccgcctcccccggcccctgccatt
ccttccacacccacctcctccatgtcccctagcacccccacctctgtctcgtcttctgaa
ggcatcagcaaacgcaagacggcgaggaagatgttccccaagaggaagctggacgacagc
ggcagtgacagtcaaaaggaggacgaggccaacaccaagattccggcggcggacgatagt
cagcggaaaaaacgagcccgtgtggacgatggcgacagagacgagtttgctgaggaagaa
agagacgacagcgaggcagcgacggagcaagtgaggacgccggataaagacagagagaat
gcggaagagattgaaaaaaagctggaggaagaggaggaagacaagaatgacgacaaggcc
gcaaaagaggaagccaagaaagctcatatcagcagcttctttgctcccagaaaggctgca
gtgaagacggagaaaaagagcgaaagagagaagaagacaggaatgacgacttcgacttcc
tccatgaaggaggacagcaaagatgccaaaagtgagtcgacggaaacggactacaaccca
tccagacccaactaccacccactcgagcatgcctgctggaaggagggacaaaaggtgcct
tacctggcgctggctcgcacctttgagaagatcgaagaggactctggcagactgagaaac
atcgagactctggccaacctgttccgctcagtgctgctgctttctccagacgacctgctg
tgctgcgtctacttgtgtctaaaccagttgggacctgcctacctcggcgtggagcttggc
attggagagacggtgctgatgaaagctgttgcgcaggccacggggcgacagctggacaag
atcaaggcagaggctcaggagcgcggggaccttggtctggtggccgagagctcccgcagc
aaccagcgcaccatgttcaggccggccagcctgacggtgggcggcgtcttcaagaagctc
aaggagatcgcaagcatgagcggcaattcggccatgaataagaagatcgacatcatcaaa
ggactctttgtggcctgccgcttctccgaggcccgctacatcgtcaggtcattagccggg
aagctgcggatcggattggccgagcagagtgtcctgtcggcgttaagtcaagccgtgtgc
ctcactacaccccagaaaggtacctctcctgccgtgatggacgccgggaaagggatgact
gccgagagcaggcgtgcttggatcgaagagaagaatcttattttgaaacagacttactgt
gagatgcccaactacgacatcctcatccccgttcttcttaaagaaggcatcgacaagctg
cccgatcactgcaaactcaccccaggcgtacccctgaggcccatgctggcgcaccccact
aagggagtcggggaggtgatgaaacgcttcgacgaggcggcgttcacctgcgagtacaaa
tatgatggcgagcgcgcgcaaattcacatcctggagagcggcgaggttcggatattcagc
cgcaaccaggaggacaacaccaccaagtaccctgacgtcatctctcgtatccccaaggtg
aagaaagactcggtggtctcctgcgtgctggattctgaggcggtggcgtgggatcgcgag
aagaaacagatccagccgttccaggtcctcaccacacgcaagagaaaggatgtggatgca
gccgacatcaaagtccaagtgtgtgtgtacgcctttgatctcctctacctcaatggagag
tctcttgtgcgacagccactgtgtcggcgtcgggagctcctgcgagagtcctttgccgaa
gcggaaggagagtttgtatttgcccgattcatcgactcggacaacacggagaccatcgca
gagttcctggagcagtctgtccgagactcgtgcgaaggcttgatggtgaagactctggag
aaggacgccacctatgaaatcgccaaacgctcccataactggctcaagttgaagaaggac
tacctggagggcgtgggggacacggtggacctgtgcgttatcggcgcctaccttggcaaa
ggcaagaggacggggacatatggcggcttcctgctagcctgctacgacgaagacaacgag
gagttccagtcggtctgcaagatcgggactggcttcaaggatgaagacctggagcagcac
cacaagttcttgaaggaacacatcttgcccaagccccgcccctactaccgcgtggaccaa
tcggccgagcccgacgtgtggctggatgctgtgcaggtttgggaggtcaagtgtgccgac
ctgtcgctgtcgcccgtgtacaaggccgccatgggaatggtggatccagagaaaggaatc
tccctgcgtttccctcgcttccttcgcatccgagacgacaagaagcccgaggacgccacg
agcggcgctcagatcgccgacctgtacaagaagcagcagcagatcctgaatcagggagac
aaagccgacacggaggactacttttga

DBGET integrated database retrieval system