KEGG   Hippocampus comes (tiger tail seahorse): 109529550Help
Entry
109529550         CDS       T04969                                 

Definition
(RefSeq) elongation of very long chain fatty acids protein 1-like
  KO
K10247  elongation of very long chain fatty acids protein 1 [EC:2.3.1.199]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00062  Fatty acid elongation
hcq01040  Biosynthesis of unsaturated fatty acids
hcq01100  Metabolic pathways
hcq01212  Fatty acid metabolism
Module
hcq_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    109529550
   01040 Biosynthesis of unsaturated fatty acids
    109529550
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hcq01004]
    109529550
Enzymes [BR:hcq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     109529550
Lipid biosynthesis proteins [BR:hcq01004]
 Elongase
  PUFA
   109529550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ELO
Motif
Other DBs
NCBI-GeneID: 109529550
NCBI-ProteinID: XP_019748529
UniProt: A0A3Q2Y1E6
LinkDB All DBs
Position
Unknown
AA seq 325 aa AA seqDB search
MLLEALSNILEFYDDLLSKCDARVKDYPLVHCPAKMTTLLVSYVVFAIYLGPRLMANRKP
FHLNTVMVVYNFGMVAFNAFIVYEFMMSGWGTTFTWRCDLIDPSSSPQALRMVRAGWLFF
FSKFIELLDTVFFVLRKKQNQITFLHVFHHSVMPWSWWWGIMLTPAGGMGSFHAMVNATV
HVIMYTYYGLAAAGPRFQRFLWWKKYMTAIQLTQFIVVSVHISQYYFMEKCDYQVPLWIH
LIWMYGVLFFVLFSNFWLQAYIRGKRLPVTQLKSGRERTPPAPPLANGTHGTHGTHQHNG
SADQNNHNQHSHTNGNVQLGKVKEI
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgctgctagaagctctatccaatattttggaattctacgatgacctgctgtccaaatgc
gacgcccgggtcaaagattacccgttggttcactgtcccgccaagatgacgaccctcctg
gtgagctacgtcgtcttcgccatctatttgggtcctcgcctgatggccaaccgcaagccc
ttccacctcaacacggtcatggtggtctacaacttcggcatggtcgccttcaacgctttc
atcgtgtacgagttcatgatgtccggatggggcaccacattcacgtggagatgtgatttg
attgatccctccagcagtcctcaagcacttcggatggtgcgagcgggttggctatttttc
ttttccaagttcattgaactcctcgacacggtattcttcgtgttgaggaagaaacaaaat
caaatcacctttctccacgtgttccatcactcggtcatgccctggtcttggtggtggggc
atcatgctgactcctgccggagggatgggctcttttcacgccatggtgaacgccacggtc
cacgtcatcatgtacacgtactacggactggcagcggcagggccacgcttccagaggttc
ttgtggtggaagaagtacatgaccgccatccagctgacacagttcatcgtggtgtcggtg
cacatcagccagtactacttcatggagaagtgcgactaccaggtgcccctgtggatccac
ctgatctggatgtacggcgtgctcttcttcgtgctcttctccaacttctggctgcaggcc
tacatccggggcaaacggctccccgtcacccaactcaagagcgggcgcgagcggaccccc
ccagcacctccgctggccaacggcacccacggcacccacggcacccaccagcacaacggc
agcgccgaccaaaacaaccacaaccagcacagccacaccaatggcaatgtgcaactgggc
aaagtaaaggagatctaa

DBGET integrated database retrieval system