KEGG   Hippocampus comes (tiger tail seahorse): 109529876
Entry
109529876         CDS       T04969                                 

Gene name
cdkn1b
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04012  ErbB signaling pathway
hcq04068  FoxO signaling pathway
hcq04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109529876 (cdkn1b)
   04068 FoxO signaling pathway
    109529876 (cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109529876 (cdkn1b)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 109529876
NCBI-ProteinID: XP_019748936
UniProt: A0A3Q2XHK0
LinkDB
Position
Unknown
AA seq 179 aa
MSDVRLSSGSPTLERSEPRLSEHPKPSACRILFGSVDHDELRRDLKGHLRELEEAAVAKW
SFDFASHSPLENDAGLRWELVDCRDVPDFYTRLERRSSGNNRLDVNGNHRCVVGEPAEER
AGGPTSCPEQCTALRKRPACHEPSTQSKRSHSSPAEYPSRSRSAEHTPRKSSGSPGRQT
NT seq 540 nt   +upstreamnt  +downstreamnt
atgtccgatgttcgactttccagcggcagcccgacgttggagcggagcgaaccgcgcttg
tcggagcacccaaaaccgtcagcctgccggatcctcttcggctcggtggaccacgacgag
ctccgtcgggatttaaagggacacctgcgggagctcgaggaggccgccgtcgccaaatgg
agcttcgacttcgcctcgcacagcccgctggaaaacgacgccgggctccgctgggagctg
gtggactgtcgcgatgtgccggacttctatacgcgactggagcgaaggagttcggggaat
aaccgtttggatgtaaacgggaaccaccgctgtgttgtcggcgagcccgcggaagagcga
gccggtgggccgacgtcgtgcccggagcagtgcaccgctttgaggaagagacctgcctgt
cacgagccctcaacccaaagtaagaggtcgcacagcagcccggctgagtatccgagccgg
agtcgctccgccgaacacacgcccagaaagagcagcggaagcccggggaggcaaacgtga

DBGET integrated database retrieval system