KEGG   Hippocampus comes (tiger tail seahorse): 109530353
Entry
109530353         CDS       T04969                                 

Gene name
bid
Definition
(RefSeq) BH3-interacting domain death agonist
  KO
K04726  BH3 interacting domain death agonist
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
hcq04210  Apoptosis
hcq04217  Necroptosis
hcq05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109530353 (bid)
   04217 Necroptosis
    109530353 (bid)
   04115 p53 signaling pathway
    109530353 (bid)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109530353 (bid)
SSDB
Motif
Pfam: BID
Other DBs
NCBI-GeneID: 109530353
NCBI-ProteinID: XP_019749542
LinkDB
Position
Unknown
AA seq 192 aa
MDDLTKLASEQNATLVVLSFLQADCSNVQYNKAVYSLGKELTETWRNSCEDNDGVIECDC
NLPGTIEGSIADIEPLVELYWPGGVGEARALQVVAAQLREIAAQLEQNVVDQSARNLHNN
VMSSPSEQWLELLKSEVHRAMMQGVGLDQLPRERVIMALSLTLVKQVCEHTPQLLRDLFN
TALQYISPTRAR
NT seq 579 nt   +upstreamnt  +downstreamnt
atggatgatctgacgaagttggccagcgaacaaaacgccactttggtggtgttgagcttc
ctccaggcggactgcagtaacgtgcagtacaacaaggctgtttactctttgggtaaagag
ctaacagaaacttggaggaacagttgcgaagacaatgatggggttatcgaatgtgactgc
aacctgcccggcaccatcgagggctccatcgccgacatagagccgttagtggagctttac
tggcctggtggtgtaggtgaagcaagagccctgcaggtggttgcagctcagctgagagaa
attgctgcccaacttgagcagaatgttgtggaccagtctgcccgaaacctgcacaacaat
gtgatgtcttcacccagtgaacagtggctggagctcctcaaaagcgaggtgcacagggcc
atgatgcagggggtgggcttggatcagctgccccgggagagggtcatcatggccctcagc
ctcaccctggtgaagcaggtgtgtgaacacaccccacaactcctcagagatctcttcaac
actgcgctgcagtacatcagcccaacaagggcaagatga

DBGET integrated database retrieval system