KEGG   Hippocampus comes (tiger tail seahorse): 109530888
Entry
109530888         CDS       T04969                                 

Gene name
kitlg
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04010  MAPK signaling pathway
hcq04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109530888 (kitlg)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109530888 (kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hcq04052]
    109530888 (kitlg)
Cytokines and growth factors [BR:hcq04052]
 Growth factors
  Growth factors (RTK binding)
   109530888 (kitlg)
SSDB
Motif
Pfam: SCF DASH_Dad4
Other DBs
NCBI-GeneID: 109530888
NCBI-ProteinID: XP_019750400
LinkDB
Position
Unknown
AA seq 271 aa
MKKPKIRIRVCVHFLLLITLGVHSSKFDVNPVTDDVSRLSILKHNIPKDYKIPVHYVPKE
EGGMCWVKLNVFYLEESLQDLAHKFGNISSNRKDISIFIQMLQELRLNMGSVEVVMYDFE
CHYREERWPTEQYFEFVSDFLASAQHRDDSDDCEPPPCPTTPYTQTEQYLKGLPSSSSKI
SECAASTDCQTEQEARLLPKVVERSLLSLLFIPFLALILLLVWKQLRSRRNSRDLPLSPG
EGVLFTGTEGRAPPLESQITETNKLNMIETV
NT seq 816 nt   +upstreamnt  +downstreamnt
atgaagaagccaaaaattcggatacgcgtctgtgtccattttctgctgctgatcacgctc
ggggtgcattcaagtaaatttgacgtcaaccctgtgacagatgacgtgtcgagactctcg
attttgaaacataatattcccaaagactacaaaattcctgtacattacgttccgaaagaa
gagggtgggatgtgctgggtaaagctcaacgttttctacctggaggagagtttacaagac
ttagcgcacaagtttggcaacatttcatccaacagaaaagacattagcatatttatacaa
atgctccaagagctacggctcaacatgggctctgtggaagtggtcatgtacgactttgag
tgccactaccgtgaggagcggtggcccaccgagcaatactttgagtttgtgtccgacttc
ctggccagcgcgcagcacagggacgactcggacgactgcgagcctcccccctgccccacc
acgccctacacgcaaacagaacaatatttaaaaggcttgccgtcgtccagcagtaaaatc
tcagagtgtgccgcatccacagactgccaaacagagcaagaagcgcgtctgcttccgaag
gttgtggagcgaagtcttctgtctttactcttcattcccttcctggctctcatcctgctg
ctcgtatggaagcagctcagatcacgacggaacagccgagatcttccgctgagtcccgga
gaaggcgttctcttcacgggaacagaagggcgcgcacctccgctagagtcccaaattaca
gaaacaaacaagttgaacatgattgaaactgtgtga

DBGET integrated database retrieval system