KEGG   Hippocampus comes (tiger tail seahorse): 109530954Help
Entry
109530954         CDS       T04969                                 

Gene name
sgk3
Definition
(RefSeq) serine/threonine-protein kinase Sgk3
  KO
K13304  serum/glucocorticoid-regulated kinase 3 [EC:2.7.11.1]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109530954 (sgk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hcq01001]
    109530954 (sgk3)
Enzymes [BR:hcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109530954 (sgk3)
Protein kinases [BR:hcq01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   109530954 (sgk3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PX Pkinase_C Kinase-like FTA2 Kdo Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 109530954
NCBI-ProteinID: XP_019750481
LinkDB All DBs
Position
Unknown
AA seq 488 aa AA seqDB search
MEEQSGLPNVSIPCHNEQRDKKKRYTVYKVIVNVGQQEWFVFRRYAEFDKLYNTLKKQFP
SLSLKIPAKRIFGDNFEPEFIKQRRAGLHEFIKGIVSLPQLCNNPDVRSFLLMDKMQNLQ
NSDASEDEDDKNNSTSRNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVFLAKRKLDSKYY
AIKVLQKKVILNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTDKLYFVLDFVNGGEL
FFHLQKERTFLESRARFYIAEMASALGYLHSLNIVYRDLKPENILLDHEGHIVLTDFGLC
KEGISQTDTTSTFCGTPEYLAPEVLRKQPYDNTVDWWCLGSVLYEMLFGLPPFYSRDTHE
MYDNILHKPLVMRAGASNAAWSLLQGLLEKDGALRLGAREDFNEIKTHPFFSTINWNDLE
QKKIPPPFTPNVNSYSDISNFDPEFTEEMVPNSVCWTQEHSIVNASVMEADDAFVGFSYA
PPSEDSFL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggaggagcaatcgggcctgcctaacgtcagcataccgtgccacaacgagcagagggac
aagaaaaagcgctacacggtttataaagtgatcgtcaacgtggggcagcaggagtggttc
gtcttcagacgctacgccgagtttgataaactttacaacacgttaaaaaaacagttccca
tctttaagtttgaagattcccgccaagaggatcttcggggataactttgaacccgaattc
atcaagcagagacgagccggcctgcacgaattcatcaaaggcatcgtgtcgcttccgcag
ctttgcaacaatccagatgtgaggagtttcctgctcatggacaaaatgcaaaacctgcag
aactctgacgcgtccgaagatgaagacgacaaaaacaattcaacttccagaaacattaac
ctcggaccctctggcaacccacacgccaaacccaccgactttgactttttaaaagtcatc
ggaaaggggagttttggaaaggtgttcctggccaaaaggaagctggactccaagtattat
gcaatcaaggtcctacagaaaaaggtcattctcaacagaaaagagcaaaaacacatcatg
gctgagcgcaacgtgctgctgaagaacgtgaaacatccctttttggtgggcctgcactac
tccttccagaccacagacaagttgtattttgtcttggatttcgtcaacggaggggaactt
ttcttccaccttcaaaaagagcggacctttctggaatcccgagccaggttctacattgcc
gaaatggccagcgcgctcggctatctgcactcgctcaacatcgtttatagggacttgaag
cctgaaaatatcctccttgaccacgaaggtcacatcgttttgacggactttggcttgtgc
aaggaaggcatttctcagacggacaccaccagtactttttgtggcacgcctgagtacttg
gctccggaggtgctgaggaagcagccgtatgacaacaccgtcgactggtggtgtctgggt
tccgtgctctatgagatgctatttggcttgccgccgttttacagcagggacacgcatgag
atgtatgacaacattctgcacaagccgctggtaatgcgcgccggcgcgtccaacgcggcc
tggtctctgctgcaaggccttctggagaaagatggagcgctcaggctgggagccagggaa
gactttaatgagatcaaaacgcaccccttcttctccaccataaactggaatgaccttgaa
cagaagaagattcctcccccatttacacccaacgtgaactcttactccgacatctcaaat
tttgatcccgagttcactgaggagatggtgcccaactctgtgtgttggacccaggaacac
tccatcgtcaacgccagtgtgatggaggccgacgacgcttttgtgggcttctcgtacgcc
ccaccctctgaggactcatttctgtaa

DBGET integrated database retrieval system