KEGG   Hippocampus comes (tiger tail seahorse): 109530980Help
Entry
109530980         CDS       T04969                                 

Gene name
sod2
Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04068  FoxO signaling pathway
hcq04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109530980 (sod2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109530980 (sod2)
Enzymes [BR:hcq01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     109530980 (sod2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 109530980
NCBI-ProteinID: XP_019750531
LinkDB All DBs
Position
Unknown
AA seq 223 aa AA seqDB search
MLCRVAQIRRCAASLSQAVQQAHRQKHTLPDLTYDYGALEPHINAEIMQLHHSKHHATYV
NNLNVTEEKYKEALAKGDVTVQVALQPALKFNGGGHINHTIFWTNLSPNAGGEPQGELME
AIKRDFGSFQSMKERMSAAAVAVQGSGWSWLGYDKQGGRLCIAACANQDPLQGTTGLIPL
LGIDVWEHAYYLQYKNVRPDYVKAIWNVINWENVSERLQTAKK
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgctctgcagagttgctcagatccgcaggtgcgctgctagtttgagtcaagccgtgcag
caggcgcacagacagaagcacacgcttcctgacctgacgtacgactatggcgccctggag
ccacacatcaacgcggagatcatgcagctgcaccacagcaagcatcacgccacctacgtc
aacaacctcaacgtgacggaggagaagtataaggaggcgcttgcaaaaggagacgtgact
gtgcaggtcgcccttcagcctgctcttaagttcaatggaggaggtcatattaaccacacc
atcttctggactaacctctctcccaacgctggcggagagccacaaggggagctcatggag
gccatcaagcgggactttggctccttccagagcatgaaggaaaggatgtctgccgccgcg
gtggcagtccaaggctcaggctggtcctggctgggctacgacaaacaaggcggaagactt
tgcatcgcagcttgcgccaaccaggatcctctgcaagggaccacaggcctaatccctctc
ctgggcatcgacgtctgggagcacgcctactacctgcagtacaaaaacgtccggcctgac
tacgtgaaggccatctggaacgtcatcaactgggagaatgtgagcgagcgtctccagact
gcaaagaaataa

DBGET integrated database retrieval system