KEGG   Hippocampus comes (tiger tail seahorse): 109531144
Entry
109531144         CDS       T04969                                 

Gene name
ei24
Definition
(RefSeq) etoposide-induced protein 2.4 homolog
  KO
K10134  etoposide-induced 2.4 mRNA
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109531144 (ei24)
SSDB
Motif
Pfam: EI24
Other DBs
NCBI-GeneID: 109531144
NCBI-ProteinID: XP_019750816
UniProt: A0A3Q2Z0D7
LinkDB
Position
Unknown
AA seq 340 aa
MTDSVRAFLRNVATGIKDSILGIGTISKLDARIQQKREEQRRRRASGALAQRRAQSEERK
PDNDPKVASRIFQCCAWNGGVFWLSLFLFYRVFIPLLQTLSAKIIGDPSLHGNVWSWLEF
ILTSVFSALWVLPLFVLSKIVNAIWFQDIADLAFEVSGCKVQPFPSVSKIIADMLFNLLL
QALFLIQGMIVSLFPIDAIGQMVSLLHMSLLYSLYCFEYRWFNHGIEMHQRLSNIERNWP
YYFGFGLPMALLTALPSSYIISGCLFSILFPLFIISANEAKTPTKLYHFQLRLFSLVVFI
SNKLFHKTVHLQSSMTSSTSSERLTSPHISPVRQRLLPTQ
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgacagacagtgtcagggccttcctccgcaatgttgcgacggggatcaaggattccata
ctcgggattggaaccatctccaagctggatgcccgcatccagcagaaaagggaggaacag
cggcgaagaagggccagcggggctttggcgcagagacgggctcaaagtgaggagcgtaaa
cctgacaatgaccccaaagtagccagcaggatctttcagtgctgtgcctggaatggagga
gtcttctggctcagtctttttctcttctaccgggtgtttatcccactactccagactcta
tctgcaaaaattattggtgacccctcgctccatggcaatgtctggtcatggttggagttc
atcctgacatctgtcttcagtgctctgtgggttctcccactgtttgtcctcagcaagatt
gtcaacgctatctggtttcaggatatagctgacttagcattcgaagtgtctggctgtaaa
gtgcaaccattcccaagtgtgagcaagatcatcgcagatatgctcttcaacctcctcctc
caggcactcttcctaattcagggtatgattgtgagcctgtttcctatcgatgccattggg
cagatggtcagtctattgcacatgtctctgctctattccctgtactgttttgagtatcgc
tggttcaaccacggcattgagatgcaccaacggctgtccaatattgagaggaactggccc
tattactttggctttggtttgcccatggctttgttgacagccttgccttcatcatatatc
atcagtggctgcttgttctccatcctcttccctctcttcatcatcagcgccaatgaggcc
aagacaccaacaaagctgtaccattttcagctgcgtctcttctcgctggtggtgttcatc
agcaacaagcttttccacaagacggtccacctgcagtcctcgatgacatcatcaacatcc
tccgagaggctcacatcccctcacatctcccctgtccgacaaagactgctgcccacacag
tga

DBGET integrated database retrieval system