KEGG   Hippocampus comes (tiger tail seahorse): 109531175Help
Entry
109531175         CDS       T04969                                 

Gene name
tmprss2
Definition
(RefSeq) transmembrane protease serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hcq01002]
    109531175 (tmprss2)
Enzymes [BR:hcq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     109531175 (tmprss2)
Peptidases [BR:hcq01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   109531175 (tmprss2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR DUF1986 SRCR Ldl_recept_a Gemini_mov DUF3810 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 109531175
NCBI-ProteinID: XP_019750870
LinkDB All DBs
Position
Unknown
AA seq 483 aa AA seqDB search
MNNNQTNGPTYDNIGFQHEESRPPPFAPQQGIYPTLPEPTPSYVAFAPIPINTHQTTTPA
APQNTTENKGRTRCAWKRILCASICVFLVLVILTLLLWYFLYYQCALGKSCRYSLKCLRT
SQWCDGVTDCLHGEDESNCFRLSGSNFMLESFSSESQSWIPVCGDRWDDNFGKAVCGQMG
YKRQDYVTYRQTNVGSLTSRGFMKLMPSSDHKSLIQSQLSFSQSCKGTSVGLRCMDCGES
SAFPSSRIVGGTEASNEVWPWQVSLQISGRGHICGGSIISSYWIVSAAHCFQRFSRPSVW
TVYSGDISLRKMSYYYGNKVEKIISHEKYDSETYDNDIALLKLDTPLTFSKRVKPVCLPN
FGMEFSAGDAAWITGWGSLRSSGPSPDKLNQALVTIYSREACNNREILNGAVTESMICAG
KLSGGVDSCQGDSGGPLVVKEADVWWLAGDTSWGIECALKNKPGVYGNVPYFLDWIYWKM
QTQ
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaataataaccagactaatggtcccacgtacgacaacatcggcttccagcatgaggaa
agtcgacccccaccattcgcgccacagcaagggatctatcctactctccctgagccgact
ccaagctacgtcgccttcgctcccataccgatcaacacccaccaaacgacgacccctgcc
gcgccacaaaataccacagaaaacaaaggaagaacgaggtgtgcatggaaacgtatcctg
tgtgcatccatatgtgtatttcttgttctggtgatcctcaccctcttattgtggtacttc
ttgtactaccagtgtgcactgggcaagtcatgcaggtatagtctgaagtgtctacgcacc
tcccagtggtgtgatggcgtcacagattgtttgcatggcgaggatgagtccaactgcttt
cgtctttctggaagcaactttatgctggagagtttctcatctgagagccaatcgtggatt
cctgtatgtggtgacagatgggatgacaattttgggaaagctgtgtgcgggcagatgggt
tacaagaggcaggattatgtaacctacaggcaaacaaatgtgggctctttaacctcgaga
ggattcatgaagctgatgcctagcagtgaccataaatcgctaatacagtcccaactctct
ttcagtcaaagttgcaaagggacatctgtcgggcttcgttgtatggattgcggagaaagt
tctgcattccccagcagtcgcattgtagggggtacggaggcttcaaatgaagtctggcca
tggcaggtcagtctccagatttctggtcgaggacacatttgtggaggctcaattatcagc
tcatactggattgtatctgctgcgcactgcttccaaaggttctccagaccatcagtatgg
accgtgtactccggcgacataagcctgcgtaaaatgagctattattacggcaacaaagtt
gaaaaaatcatcagtcatgagaagtatgactctgaaacatacgacaatgacatcgcactt
ctgaagcttgacacacctttgacattttcaaagagagtaaagccggtgtgcttgccaaac
ttcggcatggaattctcagctggagatgcagcatggattacaggttggggatctttgcga
tcatctggtccatccccagacaaactcaatcaggctttggtgacaatttacagcagagag
gcatgtaacaatcgtgaaatattaaacggggcagttacagaatcgatgatttgtgctggc
aaactgagcggaggcgtcgattcatgtcagggtgacagtggagggccattggtggtcaaa
gaggcggatgtgtggtggctggctggagacacaagctgggggattgaatgtgctctgaag
aacaagccaggggtctacggcaatgtaccctactttcttgactggatatattggaagatg
cagactcagtga

DBGET integrated database retrieval system