KEGG   Hippocampus comes (tiger tail seahorse): 109531425
Entry
109531425         CDS       T04969                                 

Gene name
tgfa
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04010  MAPK signaling pathway
hcq04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109531425 (tgfa)
   04012 ErbB signaling pathway
    109531425 (tgfa)
SSDB
Motif
Pfam: EGF UbiA Laminin_EGF Sre Spore_III_AB
Other DBs
NCBI-GeneID: 109531425
NCBI-ProteinID: XP_019751271
UniProt: A0A3Q2Y970
LinkDB
Position
Unknown
AA seq 244 aa
MTRILWDAILLISGSLFTIGAGQSTSTTLGGNFAVKSKATLNTSGSGHATASMTARSNFS
FGKKPSRSDTAISIPTKPALAAYTAAGSSGVSGGVIPTVSTIAVTTTTRTSNIPPVKKFV
AAAVRSHFDDCPDSHRHFCFHGTCRFLILEETPACICHPGFVGMRCEHADLLAVVATNHR
PQTVATVLVLCVIGCVLIIVVCTLLNCWWRQECRKRRHPHHFIPEKPVYSQKHRAPFYPP
ESVV
NT seq 735 nt   +upstreamnt  +downstreamnt
atgactcggatactatgggatgcgattttgctcataagtggttcactgtttacaatagga
gcagggcaaagcacctcgacaaccctcggaggcaactttgccgtcaaatctaaggctact
ctcaacacctcgggaagtggccacgcaaccgcctccatgactgcaaggtcaaatttttca
tttggaaaaaagccgagtcggtcagacacagccatctccatcccgaccaagccagcgttg
gctgcatacaccgcagccggcagctctggagtgtccggtggtgtcattccaacagtctcg
actatagcggtgacgactaccacgaggacctccaacatccctccggtgaaaaagtttgtg
gcggcggctgttcgctctcatttcgatgactgtccagactctcaccgtcacttctgtttt
cacggaacatgtcgcttcctgatattggaggagacacctgcatgcatatgccatcccggc
tttgtcgggatgaggtgcgagcatgcagacctgctggccgtcgtggccaccaaccaccgt
ccgcagaccgttgccactgtgctggtgttgtgtgtgattggctgcgtcctgatcattgtg
gtgtgcacgctgttaaattgttggtggagacaggaatgccgtaagaggagacacccccat
cacttcatcccagaaaagcctgtttactcacagaagcaccgagcaccattctatcctcct
gaaagcgtggtgtga

DBGET integrated database retrieval system