KEGG   Hippocampus comes (tiger tail seahorse): 109531699Help
Entry
109531699         CDS       T04969                                 

Definition
(RefSeq) trypsin-2
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hcq00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109531699
Enzymes [BR:hcq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     109531699
Peptidases [BR:hcq01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   109531699
Exosome [BR:hcq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109531699
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 109531699
NCBI-ProteinID: XP_019751707
LinkDB All DBs
Position
Unknown
AA seq 242 aa AA seqDB search
MRCLVFVLLIGAAFATEDDKIVGGYECQPHSQPHQVSLNSGYHFCGGSLVNENWVVSAAH
CYKSRVEVRLGEHNIRVTEGTEQFIRSSRVIRHPRYSSYNIDNDIMLIKLSSPATLNQHV
KTVALPSSCASAGTMCKVSGWGNTMSSTADKNKLQCLDIPILSDRDCKNSYPGMITNAMF
CAGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAEKDHPGVYAKVCIFNDWLESTMA
SY
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaggtgtctggtcttcgttctgctcatcggagctgcctttgccacggaggatgacaag
atcgtcggcggctatgagtgccagccccattcgcagccccatcaggtgtccctgaactcc
ggctaccacttctgcggaggctccctcgtcaacgagaactgggtggtgtccgccgctcac
tgctacaagtcccgcgtggaggtgcgtctgggcgagcacaacatcagggtgaccgaggga
accgagcagttcatcaggtcctcccgcgtcatccgccacccccggtacagctcgtacaac
atcgacaacgacattatgctgatcaagctgagcagtcccgccaccctcaaccagcacgtg
aagaccgtggccctgcccagcagctgcgcctccgccggcaccatgtgcaaagtctccgga
tggggcaacaccatgagctccaccgccgacaagaacaagctgcagtgcttggacatcccc
atcctgtccgacagggactgcaagaactcctaccccggcatgatcaccaatgccatgttc
tgcgccggatacctggagggtggcaaggactcttgccagggtgactctggtggccccgtg
gtgtgcaatggtgagctgcagggtgtcgtgtcctggggctacggctgtgccgagaaggac
caccccggtgtctacgccaaggtctgcatcttcaacgactggttggagtccaccatggcc
agctactga

DBGET integrated database retrieval system