KEGG   Hippocampus comes (tiger tail seahorse): 109532287
Entry
109532287         CDS       T04969                                 

Gene name
pdgfra
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04010  MAPK signaling pathway
hcq04020  Calcium signaling pathway
hcq04144  Endocytosis
hcq04510  Focal adhesion
hcq04540  Gap junction
hcq04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109532287 (pdgfra)
   04020 Calcium signaling pathway
    109532287 (pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109532287 (pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109532287 (pdgfra)
   04540 Gap junction
    109532287 (pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109532287 (pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hcq01001]
    109532287 (pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hcq04090]
    109532287 (pdgfra)
Enzymes [BR:hcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     109532287 (pdgfra)
Protein kinases [BR:hcq01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   109532287 (pdgfra)
CD molecules [BR:hcq04090]
 Proteins
  109532287 (pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 V-set Herpes_gE
Other DBs
NCBI-GeneID: 109532287
NCBI-ProteinID: XP_019752641
UniProt: A0A3Q2Y4D7
LinkDB
Position
Unknown
AA seq 1473 aa
MDGWRTFHVFFGSIITLAVTVKCGLQPPTIISDQTEFVLRPDSVFNVSCSGTGSVVWAEP
LPRNTFVLPGYMTATLFIYNATAANTGYYVCLDELLAANPAAGDPEVEHEAEIYVFVPDP
KVPFVPESPSNLVVTSDAMGASISCRVSNPNSHVTLRSVPGGEKMPVFYDNKLGFFGSLS
PGQYQCETTVEGRVLTSAIYTVKDHVEAEAEDFNVDVKVSAEELRAGQPLNITCVAPAGS
SFHQQWLHPKTQAVNAVQMKQNFPDRVVYTLVIQRAGTQDGGTYECSVTHQVSGKVRVST
VAVTVFEESSFVTLDHSGILATEFVSLLEETEFTILIHASPSPKVSWQRDGKDIPDSYYI
LTKTSHLHGNRYQSILTFRQPLERDSGTYTITAVSGSRTAQFSFALKVRSSTALTFPPSS
GPVLLPQTEEMVVALHAPFTLTCRGEARLAWDMPLDVPEQTQEDNSGLFVTTLTVDQATA
MHTGFYTCFYSHNNTDESEESSIYVYVPDPDVPFVPPGPFGNHVLSGHEEMEIQCRVSDP
SANVTLLNMDTQQPVPSVYDSKRGALGVFTAGTYICKAVINGEVHYSEEYIVHGWTGGGA
LHVELAAKRTALLVGDPITVTCLARGSEILEDHWKYPGKMANRGNKTVHENKRDQEILYT
LTIQQASAKDSGLYACSITDIMSNESQTKQLAITVYEREFLFLRPEFGSQESAELDEVRE
FRAEIDSFPGSRVTWLKDGLPLSDVTAEISTSLRQVSETRYSGVLTLIRAKEEDNGNYTM
RVENGNQTHSVSFNLKVKVPAVIVDLMDIHHGSASGQSVVCIAGGQPTPEVEWFICKNIK
HCANDSSYWAALPANSTDVQVESHVDEDNNLESQVLFGHLENTLAVRCLARNEMAADSRE
VKLVSSGPHRELTVAAAVLVLLVIVIISLIVLVVIWKQKPRYEIRWRVIESVSPDGHEYI
YVDPMQLPYDSRWEFPRDRLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTA
RSSEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRENF
LSLNPEKQKKDLDIFGINPADESSRSYVILSFESKGDYMDMKQADTTQQYVPMLEMPNTS
KYSDIQRSDYDHPPSQKGSNEMEGDNLLSDNMDEGLSTTDLLSFTYQVAKGMEFLASKNC
VHRDLAARNVLLSQGKIVKICDFGLARDIMHDNNYVSKGSTFLPVKWMAPESIFDNMYTT
LSDVWSYGILLWEIFSLGGTPYPGMVVDSSFYNKIKSGYRMSKPEHAPLDVYELMMKCWN
SEPEKRPSFLGLSDTVSSLLPSNYKRHYERVNRDFLKSDHPAVTRVCMESDDAYIGIAYK
NQGKLKDRESGFDEQRLSSDSGYIIPLPDLDPMPDDECGKRNRHSSQTSEESAIETGSSS
STFAKREGETLEDITLLDEMCLDCSDLGEDSFL
NT seq 4422 nt   +upstreamnt  +downstreamnt
atggatggttggagaacattccatgtgttctttgggtccatcataacgttggcagtcacg
gtcaagtgcgggctgcagcctcccaccatcatctccgaccagacggaattcgtcctgagg
ccagactccgtgttcaacgtcagctgcagcgggaccggcagcgttgtgtgggccgagcct
ctgccccggaatacgttcgtgttgccgggctacatgacggccacgttgttcatttacaac
gccaccgcggccaacaccggctactacgtttgcttggacgagcttttggcggcaaacccg
gcagcaggtgacccggaagtggagcacgaagccgagatttacgtttttgtcccagatccc
aaggtcccctttgtcccagagagccccagcaatctggttgtcacctcggatgccatggga
gcatccatctcctgtcgtgtgtccaatcccaactcccacgtcaccctaagaagcgtaccc
ggcggggagaagatgcccgtcttctatgacaacaagctgggcttcttcgggagcctttct
ccgggccagtaccagtgtgagacgaccgttgagggccgggtgctcaccagtgctatctac
actgtcaaagatcatgtcgaggcggaggccgaggacttcaacgtggacgtcaaagtcagc
gcggaggaattgcgggcggggcagcccctcaacatcacctgcgtggcccccgccggctcc
tcttttcaccagcagtggctccacccgaaaacacaggctgtcaatgcagttcagatgaaa
cagaactttcccgacagggtcgtgtacaccctggtgatccaacgggccggcactcaggat
ggcggcacctacgagtgctccgtcacccaccaagtcagcggaaaggtccgtgtgagcacc
gtggctgtcacagtcttcgaggaaagttccttcgtgaccctggaccacagcgggatcctc
gcgactgagtttgtcagccttctggaggaaaccgagttcaccatcctcatccatgcgtcc
ccctcgcccaaagtgagctggcagcgagatggcaaggacataccagacagttactacatt
ctcaccaaaacaagccaccttcatggcaacaggtaccagagcattctgacatttcggcag
cctctggaaagagacagcggcacgtacaccatcacggccgtgagtggctctcgcacggcc
cagttctccttcgccctcaaagtcagatcttccactgctttgactttcccgccatcctcg
ggcccggtgctgctgccacagacagaggaaatggtggtggccctccacgctcccttcacg
ctgacctgccggggcgaagcgagactggcttgggacatgccgctcgacgtgcctgagcag
acgcaggaggacaacagcggtctattcgtcacgaccctcacggtggaccaagccacggcc
atgcacactggcttctacacttgcttctacagccacaacaacacagacgagtcggaggag
agcagcatttacgtctatgtgccagatcctgatgttccttttgtgccaccggggcccttc
gggaatcacgtcctgtctggtcacgaggagatggagattcagtgtcgggtgtccgatccc
agcgcaaatgtgaccttgcttaacatggacacccagcagcctgtgccgagtgtctatgac
agcaagcgaggcgccctgggggtgttcaccgccggaacctacatctgtaaggccgtcata
aacggagaagtccactacagcgaagagtacatcgtccatggctggacgggcggtggcgct
ctgcacgtcgaactggccgccaaacgaaccgctctgttggtcggagaccccataacagtc
acctgtttggctcgcgggtcggaaatcctggaggaccactggaaataccccggcaaaatg
gcaaaccgtgggaataagacggtgcacgagaataagcgggatcaggagattctttatacc
ctgaccatccaacaagcctcggccaaagacagcggcctctacgcctgctccatcactgat
atcatgagtaacgagagccagaccaagcaactagccatcacagtttatgaacgtgagttt
ctgttcttgcggccggagtttggcagccaggaatcggcagagctggacgaggttcgtgag
ttcagggccgagatcgactcgttccccggctctcgcgtcacctggctcaaggatggactg
ccgctgagcgacgtcactgccgagatctccaccagtctgcgtcaggtcagcgagaccagg
tactcgggcgtcctcaccctgatccgtgcaaaagaggaagacaatggaaactacaccatg
agggtggagaatggaaaccaaactcacagcgtcagctttaacctcaaagtcaaagtcccc
gcggtcattgtggacctgatggacattcaccacgggtcagcttcgggccaatccgtggtg
tgcatcgccggggggcagcccactccggaagtggaatggttcatctgtaaaaacattaaa
cactgtgccaacgactcatcgtactgggcggcgctccctgccaactccacggacgtccag
gtggagtcgcatgtggacgaggacaacaacctggagagccaggttctattcggccatctg
gagaacacgttagcggtgcgctgcttggcccgcaacgaaatggccgccgacagtcgggaa
gtgaagctcgtgtccagcggccctcatcgggagctgaccgtagctgccgctgtgctggtg
ctgctggtcattgtcatcatctcactcattgtcttggttgttatctggaaacagaaaccg
cgctacgagatccgctggagggtgatcgagtccgtaagccccgacggccacgagtacatc
tacgtggatcctatgcagctgccgtatgattccagatgggagttcccgcgcgacaggctg
gtgctgggtcgcatcctgggttctggagccttcgggaaggttgtggagggcaccgcctat
ggactcagtcgctcccaacctgtcatgaaggtggcagtgaagatgctaaaacccacggcc
agatccagtgagaaacaagctctgatgtcagaactgaagatcatgactcacctcggacct
cacctcaacattgtcaacctcctgggagcctgcaccaagtcaggccccatctacattatc
actgaatactgcttctacggtgatctggtcaattatctgcacaagaatagagagaacttc
ctgagccttaacccggagaaacagaagaaagacttggacatctttggaatcaacccagcg
gacgagagcagcagaagctatgtgatcctgtcctttgagagcaaaggcgactacatggac
atgaagcaggccgacaccactcagcaatacgtgcccatgctggagatgcccaacacctcc
aaatattccgacatccagcgctcggactacgaccacccaccctcccagaaaggctcgaac
gaaatggaaggggacaacctgctgtcagacaacatggacgaaggtctcagcaccacagac
ctgctcagcttcacctaccaggtggccaagggtatggagttcctggcttctaagaattgc
gtgcaccgtgacctcgccgcccggaacgttctcctctcccagggcaagattgtgaagatc
tgcgactttgggctggccagagacatcatgcacgacaacaactacgtgtccaaaggcagc
accttcctgcctgtcaagtggatggcaccggagagcatttttgacaacatgtacaccacc
ctgagcgatgtctggtcttacggaatcctcctttgggagatattctccttaggtggaacg
ccctatcccggtatggtggtggactcgagcttctacaacaagatcaagagtggatacagg
atgtccaagccggaacacgcgcctctcgatgtctacgagctaatgatgaagtgctggaac
agcgagccggagaagaggccttcctttttgggtctgagtgacaccgtctcatctctgctc
ccttccaactacaaaagacattacgagagggtcaatcgcgacttcctgaagagcgaccac
cctgccgtgacgcgggtctgcatggagagcgacgacgcctacatcggtatcgcctacaag
aaccagggcaaactgaaggaccgggagagcggcttcgacgagcagcggctcagctccgac
agcggctacatcatcccactgcccgacctggaccccatgcccgatgatgaatgcggaaag
cggaacagacacagctcgcagacgtctgaggagagcgccatcgagacgggctccagcagc
tccacgtttgccaagcgcgagggcgaaaccctggaggacatcacgcttctggatgagatg
tgtctggactgtagcgatctaggggaggacagcttcctgtga

DBGET integrated database retrieval system