KEGG   Hippocampus comes (tiger tail seahorse): 109532684
Entry
109532684         CDS       T04969                                 

Gene name
mdm2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2 isoform X1
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04068  FoxO signaling pathway
hcq04110  Cell cycle
hcq04115  p53 signaling pathway
hcq04120  Ubiquitin mediated proteolysis
hcq04144  Endocytosis
hcq04218  Cellular senescence
hcq04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109532684 (mdm2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109532684 (mdm2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109532684 (mdm2)
  09143 Cell growth and death
   04110 Cell cycle
    109532684 (mdm2)
   04115 p53 signaling pathway
    109532684 (mdm2)
   04218 Cellular senescence
    109532684 (mdm2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109532684 (mdm2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hcq04131]
    109532684 (mdm2)
   04121 Ubiquitin system [BR:hcq04121]
    109532684 (mdm2)
Enzymes [BR:hcq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     109532684 (mdm2)
Membrane trafficking [BR:hcq04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    109532684 (mdm2)
Ubiquitin system [BR:hcq04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    109532684 (mdm2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP TFIIA
Other DBs
NCBI-GeneID: 109532684
NCBI-ProteinID: XP_019753239
UniProt: A0A3Q2YMZ1
LinkDB
Position
Unknown
AA seq 515 aa
MSWRLYKSQPQSLPQLSLPPLCTLSLCTCTHGPLTGSPIACMSTDNMDASDENKVVRPKL
ELSTLLKLAGATKDVLTFKEVMFYLGQYIIQKQLFDKKQQHIVHCAQDALGRILGVDTFS
VKEPRVFFAMLSKNLVIVRSQEESTRSFAEAASGSQTQQPTQESVAGSGPSSPNIRRRRR
RRTRSSRSNDAGPSHGLPGEEKDNGSDVDEDDDGSEGAKRTRSDSYSLTFDDSLSWCVIG
GLASGRDRRNSQSSETPSNSARSDATAAIASDSDSDNFSVEFEVESIDSDDYNEDDDALS
ADDQVYELTIFEEEDDDDSFDEDTEITEADYWSCEGCKESNPPLTRNCLRCWRLRRDWLH
SASLPAQPAACVDAPALDAEDGVDVPDGKTAVSSSAPESQESQEPPASRPPSSCSSSSQE
KLWTCDSQPSSLANSQETVGTPELERSVSAEMRLPESCLEPCLICQSRPKNGCIVHGKTG
HLMTCYVCARKLKKHNKLCPVCRLPIQAVVFTYFS
NT seq 1548 nt   +upstreamnt  +downstreamnt
atgtcctggaggctctataagagccagccgcagtctttgcctcaactctctctccctcca
ctctgcactttatctctttgcacttgcactcatggaccactgacaggctcgccgattgcc
tgcatgtcaaccgacaacatggacgcctctgatgaaaacaaagtggtgcggcccaagttg
gagctatccactttgctcaagctggcgggcgcaaccaaagacgtcctgaccttcaaggag
gtgatgttctacctgggccagtacatcatccagaagcagctgttcgacaagaagcagcag
cacatcgtgcactgcgcccaagacgcgctcggccgcatcctgggagtcgacactttctct
gtgaaagaacctcgggtttttttcgccatgctctccaagaacctggtgatcgtcaggagc
caagaagagtcgacacgaagcttcgccgaagcggcgagcggcagccagacgcaacaaccc
acacaggaaagtgtggccggaagtggcccttcatctcccaacatccgccgccggcgacga
aggcgcaccaggagctccaggagcaacgacgcaggtccctctcacggcttaccgggcgaa
gaaaaagacaacgggtctgacgtggacgaggacgacgacggcagcgagggtgcaaagagg
acccgctcggacagctactcactaacatttgatgacagcctctcctggtgtgtgattggt
ggactggcaagcgggcgggacaggcgcaacagccaatcgtcagagactccgagcaactcc
gccaggtccgacgcgacggccgccatcgccagcgactcggacagcgacaacttcagcgtg
gaatttgaggtcgagtccatcgactcggatgattacaacgaagacgacgacgctttgtcc
gctgacgatcaggtgtacgagctcaccatattcgaggaggaggacgacgacgactcgttt
gacgaagacaccgagatcaccgaagctgactactggagctgcgagggctgcaaggagtcc
aacccacctctcacgaggaactgcctgcgctgctggcgcctgcgccgggattggctgcac
agcgcctcgctgccagcccaacccgcggcttgcgtcgacgctccggctttggacgccgag
gacggcgtggatgttccggacggcaaaacggctgtttcctcctcggctcccgagtcgcag
gagtcgcaggagccgccggcctcgcggccgccctcgtcctgcagctcgtcctcgcaggag
aagttgtggacgtgcgactcgcagccgtcgtcgctcgccaactcccaggagacggtgggc
acgcccgagctggagcgcagcgtgtcggccgagatgcggctgcccgagtcgtgcctggag
ccgtgtctcatctgccagtcgcggcccaagaacggctgcatcgtccacggcaagacggga
cacctcatgacgtgctacgtgtgcgcccgcaagctgaagaagcacaacaagctgtgtccc
gtgtgtcggctgcccatccaagccgtcgtcttcacctacttcagctga

DBGET integrated database retrieval system