KEGG   Halomonas campaniensis: FF32_01070Help
Entry
FF32_01070        CDS       T03198                                 

Definition
(GenBank) membrane protein
  KO
K07058  membrane protein
Organism
hcs  Halomonas campaniensis
Brite
KEGG Orthology (KO) [BR:hcs00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    FF32_01070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: AIA73478
UniProt: A0A060AZ46
LinkDB All DBs
Position
complement(224863..225861)
Genome map
AA seq 332 aa AA seqDB search
MGKQYRGRGAGVPGDIPREGWLDIIWRVVRAARRDRITIFAAGIAFYALLALFPTIAAVI
SLWGLLFDPVEAGRQLYEISRFMPPDAANLIDQQAQEVVETTESGNVTTALVGLLVAMYI
ASKSVSILVVGLNVVYGEHEKRPLLLRGVVLVSLTSGLIIMTLVSLGFIAIVPIVVDALT
IEPPVDSVLKWLRWPALLLLMSVLIALLYRYAPYRRSAQWRWLSYGTLFATTMWLLGSGG
LSLYVRYFSTFSELYGSLGAVVALMLWFWLSAFVVLFGAELNCEMERQTCNDTTVGAARS
LGERQAFAADTVGVENPWNSENVDTRHQLQDK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
gtgggtaagcagtaccgaggtcgtggagctggcgtacctggtgatatccctcgtgagggg
tggctcgatattatttggcgtgtagtgcgtgctgcacgtcgggaccggattactatcttt
gcagcgggcatcgctttttatgccctgctggcgctatttccgaccattgccgccgttatt
tctctttggggtttgctgtttgatcctgttgaggcaggccgtcagctttacgaaattagc
cgctttatgccaccggatgcggcaaatttgattgaccagcaggctcaagaggtggtcgag
acgacggagtctggcaatgtgacgacagcacttgtggggctgttagtggccatgtacatc
gcatcgaaaagtgtttccatattagtggttggcttaaacgtagtgtatggcgaacacgaa
aagcggccgttattactgcgtggtgtcgtgctggtatcgttgacctctggtttgatcata
atgacgctagtgtcactggggtttatcgccattgtgccgatagtggttgatgcgctgacg
attgagccaccggtggatagtgttttgaaatggctgcgttggcccgcgctgttgttactg
atgagcgtgcttattgctttgctgtatcgttacgcgccttatcgacgttctgcccagtgg
cgctggttaagctatggcacgctgtttgccaccactatgtggttactaggctcaggtggc
ttgtcgctttacgtacgttacttttctacctttagtgagctgtatggctctcttggtgct
gttgtggcgctaatgctgtggttttggctgtcagcgtttgtggtgctgtttggtgctgaa
ctcaactgcgaaatggagcgccagacctgcaacgacacaacggtgggggctgctcgctca
cttggcgaacgtcaggcatttgctgccgacacggtaggtgttgaaaacccctggaatagc
gaaaatgttgatacgcgacaccagttgcaggataaatga

DBGET integrated database retrieval system