KEGG   Halomonas campaniensis: FF32_01925Help
Entry
FF32_01925        CDS       T03198                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
hcs  Halomonas campaniensis
Pathway
hcs00010  Glycolysis / Gluconeogenesis
hcs00071  Fatty acid degradation
hcs00350  Tyrosine metabolism
hcs00625  Chloroalkane and chloroalkene degradation
hcs00626  Naphthalene degradation
hcs01100  Metabolic pathways
hcs01110  Biosynthesis of secondary metabolites
hcs01120  Microbial metabolism in diverse environments
hcs01130  Biosynthesis of antibiotics
hcs01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hcs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FF32_01925
  09103 Lipid metabolism
   00071 Fatty acid degradation
    FF32_01925
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    FF32_01925
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    FF32_01925
   00626 Naphthalene degradation
    FF32_01925
Enzymes [BR:hcs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     FF32_01925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: AIA73642
UniProt: A0A060B431
LinkDB All DBs
Position
complement(420621..421649)
Genome map
AA seq 342 aa AA seqDB search
MDNTMRAAVVREFGQPLEIEEVNVPRPKRGEVLMKVAASGVCHTDLHAAHGDWPVKPSPP
FIPGHEGVGHIVAVGDGVTHVKEGDRIGVPWLYSACGYCEHCLGGWETLCESQQNTGYSV
NGGFADYTLADAGYVGRLPDAVDFIEIAPVLCAGVTVYKGLKMTDTRPGQWVVISGVGGL
GHMAVQYAKAMGLNVAAVDIDDGKLALAERLGATVTVNAMKTDPAAYLKKTIGGAHGALV
TAVSPKAFDQAQNMLRRGGTLVLNGLPPGDFPLPIFSTVLNGITIRGSIVGTRSDLQEAL
DFAAEGKVKATVATDTLDNINDVFQRMIDGKIEGRIVLDMAS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggataacacaatgcgggcggcagtcgtacgcgaattcggccagccactagagatagaa
gaagtaaacgtgcctcgtcccaagcggggagaggtgctgatgaaggtggcggcctctggc
gtttgccacaccgatttacatgcagcacacggcgattggccggtaaaaccctcgccaccg
tttattccagggcacgaaggcgttgggcatatcgtggcggtgggtgacggcgttacccat
gtcaaagagggcgatcgtattggcgtgccctggctgtactcagcctgtggttactgtgaa
cactgtttaggcggctgggaaaccctgtgtgaatcccagcaaaataccggttattcggtc
aacggtgggtttgccgactataccttggcggatgcgggctatgtagggcgtctgccggac
gccgttgatttcattgaaatagccccggttctgtgtgcgggagtgacggtttataaaggc
ttgaaaatgaccgatacccgccccggccagtgggtggttatttcaggcgtcggcggcctg
gggcacatggcggtgcagtacgcgaaagcgatggggctgaacgtcgcggctgttgatatt
gacgacggtaaattagccctagccgaacggctaggtgccactgtaacggttaacgcgatg
aaaaccgacccggcggcgtatctgaagaaaaccattggtggtgcccatggggcactggtc
acagcggtatcgccgaaggcgtttgatcaagcgcaaaacatgctgcgccgtggtggcact
ctggtgctcaatggcttgcctccgggtgacttcccactgccgatcttcagcacggtgctt
aacggtattaccattcgtggctctatcgtggggacgcgcagtgaccttcaagaagcgctg
gatttcgccgccgaaggcaaagtcaaagcgaccgtggcgaccgacacgctagacaatatc
aacgacgtcttccaacgtatgatcgacggcaagatagaaggccgtattgtgctggatatg
gcgagctga

DBGET integrated database retrieval system