KEGG   Halomonas campaniensis: FF32_02590Help
Entry
FF32_02590        CDS       T03198                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
hcs  Halomonas campaniensis
Pathway
hcs00250  Alanine, aspartate and glutamate metabolism
hcs00410  beta-Alanine metabolism
hcs00430  Taurine and hypotaurine metabolism
hcs00650  Butanoate metabolism
hcs01100  Metabolic pathways
hcs01110  Biosynthesis of secondary metabolites
hcs01120  Microbial metabolism in diverse environments
hcs02024  Quorum sensing
Module
hcs_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:hcs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    FF32_02590
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FF32_02590
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FF32_02590
   00430 Taurine and hypotaurine metabolism
    FF32_02590
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    FF32_02590
Enzymes [BR:hcs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     FF32_02590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AIA73764
UniProt: A0A060B3M1
LinkDB All DBs
Position
complement(602735..604114)
Genome map
AA seq 459 aa AA seqDB search
MTNRSRNMNDEIYGSSTLAKPLPKSGFPDDEQAPRWVCAAVRDELMLDGNARQNLATFCQ
TWEEPEVHELMDACIDKNMIDKDEYPQTAEIEARCVRMLADLWNAPEGPATGCSTTGSSE
AAMLGGLAMKRRWEARRRADGKPTEKPNLVTGPVQVCWHKFTRYWDVEHREIPMEQGRLL
MTPEEVLKYCDENTIGVVPTLGVTFTGEYEPVKAVSDALDQLERDTGLDIPIHVDGASGG
FLAPFCAPDLEWDFRLPRVRSINASGHKFGLAPLGVGWVLWREESDLPEEMIFWVNYLGG
NMKDIALNFSRPGGQIVCQYYNFVRLGREGYEKVHGACYDSAAFLAAEIAALGPFEIVFD
GERSRGIPAVSWKLKDGSDPGFTLFDLADRLRVRGWQVPAYTLPTHCEDQAIQRILVRNG
VSGDLCALLIDDMKAALSHIAAHPKQVPLAEEDASGFHH
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatcgttcccgcaacatgaatgatgaaatctacggatccagcacgttggcgaag
ccacttcccaaatccgggttccccgatgatgagcaagcaccacgctgggtctgcgctgcc
gtgcgcgacgaattgatgctggacggtaatgcacgccagaacctcgcgaccttctgccag
acttgggaggagcccgaagtgcatgagctgatggatgcctgcatcgataagaatatgatc
gacaaggacgaatatccacagactgccgagattgaagcacgctgcgtacgtatgttggct
gatctctggaatgcgcccgaagggcctgcgacggggtgttcgacgacaggctctagcgaa
gccgcaatgctaggtgggctagccatgaaacgccgctgggaggccaggcgccgtgcggat
ggtaagccaactgaaaagcccaacctcgtgactggcccagtacaagtttgctggcacaaa
tttacccgctactgggatgtcgaacatcgtgagatcccgatggagcaggggcggctgctg
atgacccccgaggaagttctgaaatactgcgacgagaacacaattggcgtggttccgacc
ctcggtgtgacctttacaggcgagtatgagcctgtaaaagccgtcagcgatgcgctcgat
cagttggagcgcgataccggtcttgatatcccaattcatgtggacggtgccagcggagga
tttttagcgccattctgcgcaccggatcttgaatgggattttcgccttccgcgggtgcgc
tcgatcaacgcgtcaggccacaagttcggcctagcgccgctcggtgtcggatgggtacta
tggcgcgaggaaagcgacctgcctgaggaaatgatcttttgggtcaattatctgggcggt
aacatgaaggacattgcgcttaatttctcgcggcctggggggcagattgtttgccaatac
tacaactttgtccggctcggccgcgaaggctacgaaaaggtgcacggagcctgttatgac
agcgcggcgttcctcgccgctgagatcgccgcattggggccgttcgagattgttttcgac
ggagaacgcagccgtggtatccctgcggtctcatggaagctgaaggacggcagtgatcct
ggcttcacactttttgatcttgccgaccgtttgcgggtacgtggctggcaggtgccagct
tatacactgccaacccattgtgaagatcaggcgattcagcgaattcttgtgcgcaacggc
gtcagcggggatttatgcgcgctacttattgatgatatgaaagcagcattgtcgcatatt
gcggcccatcccaaacaggttcctttggcagaagaggatgcttcagggttccatcactga

DBGET integrated database retrieval system