KEGG   Halomonas campaniensis: FF32_07935Help
Entry
FF32_07935        CDS       T03198                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
hcs  Halomonas campaniensis
Pathway
hcs00790  Folate biosynthesis
hcs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hcs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FF32_07935 (folP)
Enzymes [BR:hcs01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     FF32_07935 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind Exotox-A_target
Motif
Other DBs
NCBI-ProteinID: AIA74775
UniProt: A0A060BBY0
LinkDB All DBs
Position
1755208..1756125
Genome map
AA seq 305 aa AA seqDB search
MKPIVDSSSPSRAADSAYHLRCGRHSLDLSFPRVMGILNVTPDSFSDGGQHVGLDSALHH
AEQMLAEGAAMIDVGGESTRPGASPVSEQEELDRVAPVVEALVHELDALVSVDTSSPVVM
REVSALGAGMINDVRALEREGALGAAASTGLPVCLMHRQGEPQDMQQSPYYGQPVERVVA
DYLAERVAACEAVGIRRSRLLIDPGFGFGKTIEHNLRLLKYMDELRALELPLLVGMSRKS
MIGKVLGRPVEERLAGGLALAAMAVERGANILRVHDVGPTVDAVNMAWAVLQEGCETQLN
KEMMP
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgatagttgactcttcatcgccttcacgggcagcggatagcgcatatcacctg
cgctgtgggcgccattcattagatctttcgtttccacgggtaatgggtattctgaatgtt
actccggactccttctctgatggcgggcaacacgttggtctagatagcgcgctgcaccac
gctgaacaaatgttggcggaaggtgctgcgatgattgacgtgggcggggagtcgacaagg
cctggggctagccctgtatcagagcaggaagagttagatcgtgtggcacctgtggttgaa
gcgctagtgcacgagctagatgcgctggtgtcagtggataccagtagccctgtcgttatg
cgagaagtaagcgcgcttggcgctggtatgattaacgatgtgcgagcgctagagcgcgag
ggtgcgctcggcgctgcagcaagcaccggcctgcctgtgtgtttaatgcatcgccaaggt
gagccccaggatatgcagcagtcgccctattatggtcagccagttgagcgagtggttgcc
gactatcttgctgagcgggtagcggcatgtgaagccgttggaattcgtcgtagccgtcta
ttgatagatcctggttttggttttggcaaaaccattgaacataacctgcgcttgctgaag
tatatggatgagcttcgggcgctggagttgccgctgttagtggggatgtcgcggaaaagc
atgattggtaaagtgttgggtcgcccggtggaagagcgcttggccggaggtcttgcgcta
gcagccatggcggttgagcggggcgccaatattttgcgcgtgcatgatgtagggcccacg
gtagatgccgtaaatatggcatgggcggtgcttcaggaaggctgcgagacgcagctaaat
aaggagatgatgccatga

DBGET integrated database retrieval system