KEGG   Halomonas campaniensis: FF32_09650Help
Entry
FF32_09650        CDS       T03198                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
hcs  Halomonas campaniensis
Pathway
hcs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hcs01100  Metabolic pathways
hcs01110  Biosynthesis of secondary metabolites
hcs01130  Biosynthesis of antibiotics
hcs01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hcs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FF32_09650 (aroK)
Enzymes [BR:hcs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     FF32_09650 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 Cytidylate_kin AAA_33 AAA_16 Cytidylate_kin2 AAA AAA_22 ABC_tran AAA_5 RNA_helicase AAA_24 AAA_25 AAA_29 APS_kinase ParA TsaE
Motif
Other DBs
NCBI-ProteinID: AIA75100
UniProt: A0A060BCU9
LinkDB All DBs
Position
2123253..2123819
Genome map
AA seq 188 aa AA seqDB search
MQELPNIFLIGPMGAGKSTIGRLLAAELSRSFFDSDHAIQDRCGADIPWIFDVEGEPGFR
QRESQMIDELTQLSGVVVATGGGAVLREENRRALRERGAVVYLLTTVDQQLKRTAKDRNR
PLLQCDNREQVLNDMFATRDPLYRATSDITVRTDRRSPRAVVNEILRRVHRMVDPLEIAR
AQSKKVSQ
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgcaagagttacccaatatttttttaattggccccatgggggctggcaagagcacgata
ggccgcttactcgcggctgagttgtcgcgctcgttctttgacagtgatcacgccatacaa
gaccgctgtggtgcggatatcccctggatttttgacgttgaaggtgaacccggctttcgt
cagcgcgaaagccagatgattgacgagctcactcagttatctggtgtggtagtggctacc
ggcggtggcgcagtgctgcgcgaagagaatcgacgtgctctgcgtgagcgaggcgccgtg
gtttatttgctgaccaccgttgaccagcaactgaagcgcactgccaaagatcgaaatcga
ccgctattacagtgtgataatcgcgaacaggtgctgaacgacatgttcgccacacgagat
ccgctgtatcgagcaacatctgatattacggtgcgcacggatcggcgcagcccacgtgcg
gtggtcaacgaaattctgcgtcgtgtccatcgcatggtggaccctttagaaattgcgcgg
gctcaaagtaaaaaggtatcacaatga

DBGET integrated database retrieval system