KEGG   Halomonas campaniensis: FF32_17970Help
Entry
FF32_17970        CDS       T03198                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K06857  tungstate transport system ATP-binding protein [EC:7.3.2.6]
Organism
hcs  Halomonas campaniensis
Pathway
hcs02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:hcs00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    FF32_17970
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hcs02000]
    FF32_17970
Enzymes [BR:hcs01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.6  ABC-type tungstate transporter
     FF32_17970
Transporters [BR:hcs02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Tungstate transporter
    FF32_17970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_16 AAA_29 AAA_22 Mg_chelatase AAA_30 AAA_23 Cellulase
Motif
Other DBs
NCBI-ProteinID: AIA76662
UniProt: A0A060BCE3
LinkDB All DBs
Position
3858312..3859058
Genome map
AA seq 248 aa AA seqDB search
MNASVFPPASYPQSLMTTVPSLHFDQVSFEHRGHRLLAPTTLTLSGCQRTLIMGPNGAGK
SLLMRLAHGLLSPSSGHVSWQGEPPAQAMVFQRPVLLRRSAIDNLTYALAVSGVPRRQRK
HMALQALEKFGLVALAKRPARVLSGGEQQRLALARAWLLNPAVLFLDEPTSALDPAAIKA
VEDAVNEFHQNGTRIIMTTHDLHQARRLADEVVFMYSGQVLEHTQAQHFFDTPASTQAGA
FIRGELVW
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgtctgtttttccaccagctagttatccccagtctcttatgacgaccgtgcct
tcgctgcattttgatcaggtcagttttgagcatcgcggccatcgtttactcgcccccacc
acgctgacactctcaggctgccagcgcacacttattatgggtcccaacggtgcgggaaag
agcctgttaatgcgtttggcccacggcctgctctcccccagcagtggccacgttagttgg
cagggagagccgcctgcccaagccatggtattccagcgcccggtgctactgcgccgctcg
gcaatcgataatttgacctatgccctggcagttagcggagtgccacgtcggcagcgcaaa
cacatggccctgcaggcactcgaaaaatttggcttagtcgcgcttgctaagcgtcctgcc
cgggtgctctccggcggcgaacagcagcgccttgcgcttgctcgtgcctggttacttaac
cctgccgtgctgtttttagatgagcctacatctgctctagaccctgctgctatcaaggcg
gttgaagatgcggtaaatgaatttcaccagaacggcacccgcatcattatgacgacccac
gacctgcatcaagcacgccgcctggctgatgaggtggtgtttatgtatagcggtcaagtg
ctagagcacacacaggcccaacacttttttgacacgccagcttccacacaagcgggagcc
tttattcgcggcgaacttgtttggtaa

DBGET integrated database retrieval system