KEGG   Halomonas campaniensis: FF32_18150Help
Entry
FF32_18150        CDS       T03198                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
hcs  Halomonas campaniensis
Pathway
hcs00473  D-Alanine metabolism
hcs01100  Metabolic pathways
hcs01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hcs00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    FF32_18150
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    FF32_18150
Enzymes [BR:hcs01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     FF32_18150
Peptidoglycan biosynthesis and degradation proteins [BR:hcs01011]
 Precursor biosynthesis
  Racemase
   FF32_18150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AIA76698
UniProt: A0A060B8F6
LinkDB All DBs
Position
complement(3896819..3898078)
Genome map
AA seq 419 aa AA seqDB search
MKYPLTLLAAAVAATVTTTSYAAPLLSDQALLVDSPEHLSANAWVEISQSAFEGNVRGVL
ELLGEEAELCAIMKADAYGHGIANLMPSVIALGIPCIGVASNEEARVVRASGFDGRLMRV
RSATPEEVRGAFDYDMEELFGDITAARQASSDAAEAGVTLRYHLGLNAGGMGRNGMALDS
EAGRQEALELQDLASLELVGIMTHFAFEDEDFVRQGLEAFHEQSDWLIETANLDREALTL
HAANSFTTMEVPEARLDMVRPGGLLYGDLPHYEQFKPVMSFRTRVASVNDYAQGSGVGYD
NVRVLERDSLLANLPVGYSDGYRRVFSDAAFVLVNGERVPVMGRVSMNTTMVDVTDVEGV
AAGDEVVLYGLQGDERITIGELEDLNSALLADLYTVWGNSNPKVLRPSDSDTGTGSDSE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatccactaaccctgttagctgccgctgttgctgccaccgttactactaccagc
tatgcggcgccgttgctgagcgaccaagcattgctcgttgatagcccagaacacttgagt
gccaatgcctgggtagaaatctcgcaatcggcttttgaggggaacgttcgcggtgttctg
gaattattgggcgaagaagcggagctttgcgccattatgaaagccgatgcctatgggcac
ggcattgctaatttaatgccttccgtgatcgcgttaggtattccttgtattggtgtggcg
agtaacgaagaagcgcgggttgttcgggcatctggtttcgatgggcgtttaatgcgcgtg
cgcagtgcgacaccagaagaagtgcgcggtgcctttgattacgacatggaagagttattc
ggcgatataacagccgcccgccaagcatccagcgatgcagctgaggcaggggtaacactg
cgctatcatttgggcctgaatgctggtggtatggggcgcaatggcatggcgcttgatagt
gaagcaggacgccaggaagcgttagagcttcaagacttagcgtcgttagagctggtgggc
atcatgacccactttgcttttgaggacgaagattttgttcgccaggggctggaagcgttt
cacgagcaaagtgactggttaatcgagacggctaacctggatcgcgaggcgctaacgctt
cacgccgccaactcatttaccaccatggaagtgcctgaagctcgccttgatatggtacgc
ccgggtggcttgctgtatggcgatctaccccattatgagcagttcaagccggtgatgtcg
tttcgcacgcgggtagcatcggtcaacgattacgcgcaaggcagtggcgttggctacgat
aatgtcagggtgttggagcgcgatagcttattggcgaatttacctgttggctattctgac
ggctatcggcgtgttttcagtgacgctgcctttgtactggtcaacggtgagcgagtgccg
gtcatgggaagagtgtcgatgaacacgaccatggtcgacgtgacggatgtcgagggagtg
gcagcgggtgatgaagtggtgctttacgggctccagggtgacgagcgaattaccattggt
gaacttgaagacctcaatagtgcgctactcgccgacctttacacggtatggggaaactct
aacccgaaggtgttgcgtccaagcgatagcgatacaggtacaggtagtgatagcgagtaa

DBGET integrated database retrieval system