KEGG   Heliorestis convoluta: FTV88_1496Help
Entry
FTV88_1496        CDS       T06277                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
hcv  Heliorestis convoluta
Brite
KEGG Orthology (KO) [BR:hcv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FTV88_1496 (ahpF)
Enzymes [BR:hcv01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     FTV88_1496 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored DAO Thi4 FAD_binding_3 AlaDh_PNT_C NAD_binding_8 K_oxygenase Glutaredoxin Lycopene_cycl FMO-like
Motif
Other DBs
NCBI-ProteinID: QGG47621
UniProt: A0A5Q2MZY1
LinkDB All DBs
Position
1454919..1456448
Genome map
AA seq 509 aa AA seqDB search
MQLDAEIKEQLGQYLELLENNVLIKVSAGSDNVSKDMMALLDEIANMSPKITVEKTALAR
TPSFSVNPIGEDSGVTFAGIPLGHEFTSLVLALLQVSGRPPKIDQKLIEQIKRIQGEYHF
ETYISLECHNCPEVVQALNVMSIFNKGITHTMIDGATFRDEVEKNNIMAVPTIYRNGEYF
SSGRMTLEEILAKMGNIVDVSDFDRKEPFDVLVVGGGPAGVSAAIYAARKGIRTGIVAER
FGGQVMDTMSIENFISVKYTEGPKLAASFREHVENYDIDVMNLQRARSLEKKEFIEITLE
NGAVLKSKTVIIATGARWRDLGVPGEAEFKNKGVAYCPHCDGPIFKGKDVAVIGGGNSGI
EAAIDLAGIVKHVTVLEFMPELKADAVLQERLYSLSNVAVLKNVQVKEITGTDKVNGLTY
LEREPGTVKHIDLQGLFIQIGLLPNTDWLGDKVERNRIGEIIVDSYGATNLPGLFAAGDC
TNSPYKQIVISMGSGANAALSAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgcaactagacgctgaaattaaggaacaacttggtcaatacctagagttgctggagaac
aacgtgctcatcaaggtgagtgctggctctgataatgtatcgaaggacatgatggctcta
cttgatgaaatcgccaacatgtcaccaaaaattacggtagagaaaacagcgttagcaaga
acgccaagctttagtgtaaatcctatcggtgaagatagtggtgtaacttttgcaggaatt
cctttagggcatgaattcacttcactggtattagctttgctgcaagtgagtggcagacct
ccaaagattgatcagaaattaatagagcaaattaaaaggatccaaggggaataccatttt
gaaacgtacatcagcctagagtgccacaactgtccagaagttgtacaagctctaaacgta
atgagtattttcaataagggtattacccacaccatgatagacggtgctacctttagagat
gaagtagaaaaaaataacatcatggctgtaccaaccatttatcgtaatggtgagtatttc
agcagtggtcggatgacacttgaagaaattcttgctaagatgggcaatattgtggatgtt
tcagattttgataggaaagagccctttgatgtgcttgttgttggaggtgggcctgccgga
gttagcgcagcgatttatgcagcacgtaaaggcattcgcacaggcattgtggcagaacgc
ttcggtggccaggtcatggacaccatgagcattgagaactttatcagtgtaaaatataca
gaagggcccaaattagcagctagctttagggaacacgtcgaaaattatgatattgatgtg
atgaatctacaacgggcacgtagcttagagaaaaaggaattcatcgagattacacttgaa
aatggtgctgttttaaagagtaagacggtcatcatagctacgggcgctcgttggagagat
ttaggcgtaccaggagaagctgaattcaagaacaaaggtgtagcctactgccctcactgt
gacgggcctatatttaaaggaaaagacgtagcagtcattggcggtggtaattctggcatt
gaagcggccattgatcttgcaggcattgtaaaacatgtaactgtgcttgagttcatgcca
gagttgaaagccgatgcagtgcttcaagagcgtctatacagtttgtccaatgtcgctgtt
cttaaaaatgtgcaagtaaaagaaattaccggtacagataaagtgaatggtcttacctat
ttggagcgagaaccaggaacggttaagcatattgatttgcagggcctattcatccagata
gggttgttgccaaatacagattggttaggcgataaagtggaacggaatcgtatcggtgaa
atcatcgttgatagctatggtgctaccaaccttcccggtctatttgctgcgggagattgt
accaacagcccctataaacaaattgttatttctatgggctcaggcgccaatgcggcctta
agtgcatttgattatttaataagaaactaa

DBGET integrated database retrieval system