KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0718Help
Entry
HDEF_0718         CDS       T00911                                 

Gene name
tufB
Definition
(GenBank) protein chain elongation factor EF-Tu; possible GTP-binding factor (duplicate of tufA)
  KO
K02358  elongation factor Tu
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Brite
Translation factors [BR:hde03012]
 Eukaryotic Type
  Elongation factors
   HDEF_0718 (tufB)
 Prokaryotic Type
   HDEF_0718 (tufB)
Mitochondrial biogenesis [BR:hde03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    HDEF_0718 (tufB)
Exosome [BR:hde04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   HDEF_0718 (tufB)
  Exosomal proteins of breast cancer cells
   HDEF_0718 (tufB)
  Exosomal proteins of colorectal cancer cells
   HDEF_0718 (tufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: ACQ67451
UniProt: C4K4F8
LinkDB All DBs
Position
complement(711982..713166)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERKKPHINVGTIGHVDHGKTTLTAAITTVLSKKYGGQARAFDQIDNAPEEKARG
ITINTSHVEYETPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLARQVGVPYILVFLNKCDMVDDAELLELVEMEVRELLSQYDFPGDDTPIIQGSALKALE
GDEAYQEKIVELANALDKYIPEPQRDIDKPFLLPIEDVFSISGRGTVVTGRVERGMIKTS
DSVEIVGIKDTVTTTCTGIEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGSIN
PHTKFEAEVYILTKEEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKML
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVIK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaagaaaaatttgaacgtaaaaaaccacatataaacgtgggaacaataggtcac
gttgaccatggtaaaacaaccttaacagcggctattaccactgttctgtctaaaaaatat
gggggtcaggctcgtgcgtttgaccaaattgataatgcaccagaagaaaaagcccggggc
attaccatcaatacctctcatgttgaatacgaaactccaactcgtcactatgcgcatgtc
gactgcccgggacatgccgattacgttaaaaacatgataacaggtgcggcgcagatggat
ggggctattttagtcgtggccgctacagacggcccgatgcctcaaactcgtgagcacatt
ttgttagcacgtcaggtaggggttccttacattcttgttttcttaaacaaatgcgacatg
gtggatgatgcagagttattagaactcgtagaaatggaggtgagggaactgttgtctcaa
tatgacttcccgggtgatgatacaccgataatacaaggctcagccctgaaggcgttagag
ggagatgaggcatatcaagaaaagattgtagagctggcaaatgctctagataaatacatt
cctgagccacaacgtgatattgataaaccatttttactgcccatagaagatgtattttct
atttcagggcgaggcacggtggtcacaggtcgtgtagaaagaggaatgatcaaaacctca
gattcagtagaaattgtggggattaaagatacggtaacaacgacctgcacaggaatagaa
atgtttcgcaaactgttagatgaagggcgagcgggagaaaacgttggtgttcttttgaga
ggcattaagcgagaagagattgaacgaggccaagtactggcgaagccaggatctataaac
ccccatactaagtttgaagctgaagtgtatattttaacaaaagaagaaggaggacgtcat
actcccttttttaaaggttaccgtccccaattttatttccgtacaacagatgtgacgggg
acaattgagcttccagaaggggtagaaatggtgatgcctggtgataacattaaaatgcta
gtgactctgattcatccgattgcaatggacgacggtctccgctttgctatcagggaaggg
ggacgtaccgtaggtgcgggggtggttgctaaagttattaaataa

DBGET integrated database retrieval system