KEGG   Hartmannibacter diazotrophicus: HDIA_0404Help
Entry
HDIA_0404         CDS       T05217                                 

Gene name
pstB_2
Definition
(GenBank) Phosphate import ATP-binding protein PstB
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
hdi  Hartmannibacter diazotrophicus
Pathway
hdi02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:hdi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    HDIA_0404 (pstB_2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hdi02000]
    HDIA_0404 (pstB_2)
Enzymes [BR:hdi01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     HDIA_0404 (pstB_2)
Transporters [BR:hdi02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    HDIA_0404 (pstB_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA_15 AAA_23 RsgA_GTPase AAA_29 AAA_16 Rad17 AAA_30 TniB AAA_33 AAA_5 AAA_25 AAA_18 AAA AAA_28 Adeno_IVa2
Motif
Other DBs
NCBI-ProteinID: SON53945
UniProt: A0A2C9D397
LinkDB All DBs
Position
1:439744..440571
Genome map
AA seq 275 aa AA seqDB search
MSNEPLLDRHPQDAAAAAPAKARQAPVRVSIRNLNFHYGQTRALKDINLDLPDRTVTAFI
GPSGCGKSTLLRVLNRMYDLYPNQRADGEVLLDGDNILARGADLNNLRARVGMVFQKPTP
FPMSIFENIAFGLRQSTDMAGSEIADRVEQALRRAALWDEVKDKLGKSGQSLSGGQQQRL
CIARTIAVEPEVLLLDEPASALDPISTAKIENLIEELKEDYCICIVTHNMHQAIRVSQKT
AFMYLGELVEAGDTEQIFVTPRNERTKDYVTGRFG
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgaacctctccttgaccggcacccgcaggacgcggcggcggccgccccggcc
aaggcgcgccaggcgcccgtccgtgtgtcgatccgcaacctcaatttccattacgggcag
acgcgggcgctgaaggacatcaacctcgacctgccggaccgcacggttaccgccttcatc
ggcccctcgggttgcggcaagtccactctgttgcgggtgctcaaccgcatgtacgacctt
tatccgaaccagcgggcggacggcgaggtgctgctcgacggcgacaacatcctcgcgcgc
ggcgcggacctcaacaacctgcgcgccagggtcggcatggtcttccagaagccgacgccc
tttccgatgtcgattttcgagaacatcgccttcgggctgcgccagtcgaccgacatggcc
ggaagcgagatcgccgaccgtgtcgagcaggcgctgcgccgcgccgcgctctgggacgag
gtcaaggacaagctcggcaagtccggccagagcctgtcaggcggccagcaacagcggctc
tgcatcgcccgcaccatcgcggtcgagccggaagtcctccttctcgacgagccggcctcc
gcgctcgatccgatctcgaccgccaagatcgagaacctgatcgaggaactgaaggaggat
tattgcatctgcatcgtcacccacaacatgcaccaggcgatccgcgtctcgcagaagacc
gccttcatgtatctcggcgaactcgtcgaggcgggggacaccgagcagatttttgtgacg
ccgcgcaacgagcgcacgaaggactatgtcaccggccgctttggctga

DBGET integrated database retrieval system