KEGG   Hartmannibacter diazotrophicus: HDIA_0690Help
Entry
HDIA_0690         CDS       T05217                                 

Definition
(GenBank) D-xylulose reductase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
hdi  Hartmannibacter diazotrophicus
Pathway
hdi00040  Pentose and glucuronate interconversions
hdi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hdi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HDIA_0690
Enzymes [BR:hdi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     HDIA_0690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_2 NAD_binding_7 UDPG_MGDP_dh_N DUF4047
Motif
Other DBs
NCBI-ProteinID: SON54231
UniProt: A0A2C9D376
LinkDB All DBs
Position
1:756735..757787
Genome map
AA seq 350 aa AA seqDB search
MKSLVLEKKDELSLRDFPAIDREEEVLGPRDVRIKLHTVGICGSDVHYYTHGRIGPFVVK
EPMILGHEASGVVIETGSEVQTLKVGDRVCMEPGIPDPNSRATRLGMYNVDPAVRFWATP
PVHGILRPTCVHPEAFTFKLPDNVSFAEAAMVEPLAVGVHAATKARVKPGDIGVVMGAGP
IGLVTALSALAAGCARVYVTDLAEKKLEIAESLSPAITGVNVAKEDVAALVKRHTEGWGA
DLVFEATGSPKAAAQVFEPLAPGGCVVMIGGQPDPVSYDAGAAMVREARVENIFRYAHVF
PRCVAMLSSGAIDVKPLITRTFEFEDSVRAFEIAASAPPADVKMQIELPQ
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctctcgttctcgaaaagaaagacgaactgtcgctgcgcgacttcccggccatc
gaccgcgaggaggaggtgctgggcccgcgcgatgtgcgcatcaagctgcacaccgtcggc
atctgcggatcggacgtgcactactacacgcacggccggatcggcccgttcgtcgtcaag
gagccgatgatcctcggtcacgaggcctccggggtcgtcatcgagacgggctccgaggtg
cagacgctgaaggtcggcgaccgggtctgcatggagccgggcattcccgaccccaacagc
agggcgacgcgcctcgggatgtacaacgtcgacccggcggttcgcttctgggcgacgccg
cccgtgcacggaatcctgcggccgacatgcgtccaccccgaagccttcaccttcaagctg
cccgacaatgtgagctttgccgaggccgcgatggtcgagcctctggccgttggcgttcac
gccgcgaccaaggcgcgggtcaagccgggcgacatcggtgtggtcatgggcgcggggccg
atcggcctggtgacggcgctttcggcgctcgcggccggctgcgcccgggtctatgtgacc
gatctggcggaaaagaagctcgagatcgccgaaagcctcagcccggccatcaccggggtg
aacgtcgcgaaggaagacgtcgcggcgctcgtcaagcgccacacggagggctggggcgcc
gatctggtcttcgaggcgaccggatcgccgaaggccgcggctcaggtgttcgaaccgctc
gcgcccggcggatgcgtcgtgatgatcggcggtcagcccgacccggtcagctacgacgcg
ggcgccgccatggttcgcgaagcgcgggtggagaacatcttccgctatgcgcatgtcttc
ccgcgctgcgtggcgatgctgagttccggcgcgatcgacgtgaagccgctcattaccagg
acattcgaattcgaagacagcgtgcgtgcattcgagatcgccgcatcggccccgccggct
gacgtgaagatgcagatcgagttgccgcaatag

DBGET integrated database retrieval system