KEGG   Hartmannibacter diazotrophicus: HDIA_1150Help
Entry
HDIA_1150         CDS       T05217                                 

Gene name
dme
Definition
(GenBank) NAD-dependent malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
hdi  Hartmannibacter diazotrophicus
Pathway
hdi00620  Pyruvate metabolism
hdi01100  Metabolic pathways
hdi01120  Microbial metabolism in diverse environments
hdi01200  Carbon metabolism
Module
hdi_M00169  CAM (Crassulacean acid metabolism), light
Brite
KEGG Orthology (KO) [BR:hdi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HDIA_1150 (dme)
Enzymes [BR:hdi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     HDIA_1150 (dme)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M
Motif
Other DBs
NCBI-ProteinID: SON54691
UniProt: A0A2C9D4I9
LinkDB All DBs
Position
1:1240500..1242785
Genome map
AA seq 761 aa AA seqDB search
MANERLTGPELDEAALYYHRSPRPGKLEIRATKPLGNQRDLALAYSPGVAAPCLAIRDDP
ANAALYTGRGNLVAVVTNGTAVLGLGAIGPLAAKPVMEGKAVLFKKFAGIDVFDIEVDET
AIERVVDVVAALEPTFGGINLEDFKAPECFEIETRLRERMKIPVFHDDQHGTAIIVAAAI
VNGMELAGKKLEDIKIVTSGAGAAAIACLNLMVSLGVKRENIWVTDIDGVVYKGRPTLMD
RWKEVYAQETDKRALVEVIGGADVFLGLSVGGILKPEMLLQMAEKPLVMALANPNPEISP
ELAIATRPDAMICTGRSDYPNQVNNVLCFPYIFRGALDVGATQINEEMKQAAVKAIAALA
KEEPPERASQTYAGEADSFGPNYLIPPPLDQRLILRIAPAVARAAMESGVAMAPITDFDA
YQDRLNRFVFRSGLTMKPVIAAAKKEAKRVVLADGEDERVLRAAQVILEDGIAKPILIGR
PAVVETRLKRFGLKIRPGRDFEIINPEDDPRYRDYVDLYLDKVARKGVTPDAARTIVRTN
ATVIGALSVVRGDADALITGLEGRFIRHIEHLRGIIGFAPGATDYFALSLLISNRGPLFL
TDTYVTPDPNPEELAQMTMMAAAEIRRFGITPRAALLSASNFGSREGVSGAKMRDALAIL
REKVPDLEVDGEMHGDAALSLLDRSRVMPKSTLKGEANLLVFPDLDAANITLSVLKISTD
ALHVGPILIGPAKAVHMITPSVTSRGVVNMTAIAAMTAVDK
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atggccaacgagcgactgaccggacctgagctggacgaagccgcgctttattatcaccgc
tcgccgcggcccggtaagctggaaatccgggcgacgaagccgctcggcaaccagcgcgac
ctggcgctggcctattcaccgggtgtcgccgcgccttgtctggccatcagggacgacccg
gccaacgccgccctctacaccggccgaggcaatctcgtcgccgtggtcacgaacggcacg
gccgtgcttggtcttggagcgatcggtcctctggcggccaagcccgtcatggaaggcaag
gccgtcctcttcaagaaattcgccggcatcgacgtcttcgacatcgaggtcgacgagacc
gccatcgagcgcgtggtcgatgtggtcgcggcgctggagccgaccttcggcggcatcaac
ctggaagacttcaaggcgccggaatgcttcgagatcgagacccggctgcgcgagcggatg
aagatccccgtcttccacgacgaccagcatggcaccgcgatcatcgtggccgctgccatc
gtcaacggcatggaactggccggcaagaagctggaagacatcaagatcgtcacctccggc
gcgggcgccgcggcgatcgcctgtctcaacctgatggtctcgcttggcgtgaagcgggag
aacatctgggtcaccgacatcgacggcgtcgtctacaagggccgcccgacgctcatggac
cgctggaaggaggtctatgcgcaagagaccgacaagcgggcgctggtcgaggtcatcggc
ggggcggacgtcttcctcggcttgtccgtcggcggcatcctgaagcccgagatgctgctg
cagatggccgaaaagccgctggtgatggcgctcgccaatccgaacccggaaatctcgccg
gaactggccattgccacccgtcccgatgcgatgatctgcaccggccggtcggactatccc
aaccaggtcaacaacgtcctctgcttcccctatatcttccgcggcgcgctcgatgtcggc
gcgacgcagatcaacgaggagatgaagcaggcggcggtcaaggccatcgcggcgctcgcc
aaggaagagccgccggagcgtgcttcccagacctacgccggcgaggccgacagcttcggg
ccgaactatctgatcccgccgccgctcgaccagcgcctcatcctgcgcattgccccggcc
gttgcgcgggccgcgatggaaagcggcgtcgccatggcgccgatcaccgatttcgacgcc
tatcaggaccgcctgaaccgcttcgtcttccgctccggtctcaccatgaagccggtgatt
gcggcggcaaagaaggaggccaagcgcgtcgtgctggccgacggcgaggacgagcgtgtc
ctgcgcgccgcccaggtcattcttgaggacggcatcgccaagcccatcctgatcggccgt
ccggccgtggtggaaacgcggctgaagcgcttcggtctcaagatcaggcccggccgcgac
ttcgagatcatcaacccggaagacgatccgcgctaccgcgactatgtcgacctctacctc
gacaaggtcgcacgcaagggtgtgacgcccgatgccgcccgcaccatcgtgcgcaccaac
gccaccgtcatcggtgcgctgtcggtcgtccggggcgatgcggacgctctcatcaccggc
cttgaaggccgcttcatccgccatatcgagcatctgcgcggtatcatcggctttgcgccg
ggcgccacggactatttcgccctgtcgctgctgatttccaaccgtggcccgctgttcctg
acggacacctatgtgacaccggacccgaacccggaagagcttgcccagatgacgatgatg
gcggcggcagaaatccggcgcttcggcatcacgccgcgtgccgcgcttctgtcggcgtcg
aacttcggctcccgcgagggcgtttccggcgccaagatgcgcgatgcgctggccattctg
cgcgagaaggtccccgatctcgaggtcgacggcgaaatgcacggcgatgcggcgctctcg
ctgctcgaccggtcgcgcgtcatgccgaaatcgaccttgaagggcgaggcgaacctcctc
gtcttccccgatctcgacgccgccaacatcacgctgtcggtcctgaagatctcgacggac
gccctccacgtcggcccgatcctcatcggtccggccaaagcggtgcacatgatcaccccg
tcggtgacctcgcgcggcgtcgtcaacatgacggccatcgccgcgatgacggccgtggac
aaatag

DBGET integrated database retrieval system