KEGG   Hartmannibacter diazotrophicus: HDIA_2395Help
Entry
HDIA_2395         CDS       T05217                                 

Gene name
amyD
Definition
(GenBank) Glucoamylase amyD
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
hdi  Hartmannibacter diazotrophicus
Pathway
hdi00500  Starch and sucrose metabolism
hdi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hdi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HDIA_2395 (amyD)
Enzymes [BR:hdi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     HDIA_2395 (amyD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: SON55936
UniProt: A0A2C9D6L4
LinkDB All DBs
Position
1:complement(2554971..2556320)
Genome map
AA seq 449 aa AA seqDB search
MSKQDDSLPLGDWIAVQERRCAGYLTRSLSRTDLVHERPEFGQQVSPLPGTVLASPVSAH
WDPEPDYFYHWTRDAAIVMEEVSHLGFTGTEADAFDFRSAFDDYVAFSLGTTRIDGNAFV
PNPIRPSTREDCLKFVRPDEELARLDAFNLPGEPRFNPDGTPDLQRWARPQYDGPALRAL
TLARHAGLLLERGEPIATDLLAILQGDLEFTIRHAGKPCIGPWEEDNEHTLHSFTLICQI
GALEHGRKLLDLLGDAFAMAGLQEAIDEAQAALTSLWNDELSIQMAHGAMDPATPAEAVD
TNILMAALHADLPDGDWSLSDARVERIVEVLTEMFSNLYPINATLPDGEGPLIGRSLHDR
YFGGNPWFATSLALAEYHYRRASGAERTERLSQGDAIVAACRRFIPEDGAMSEQIDRATG
EPLSARHLTWSYAAFLAAASARREALASD
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcaggacgattcgctgccgctcggcgactggatcgcggtgcaggaacggcga
tgcgccggctacctgacgcggagcctgtcgcgcacggatctcgttcatgaacgaccggag
ttcggccagcaggtgagtcccctgcccggcacggtgctcgcctcgcccgtctccgcgcat
tgggacccggagccggactatttctatcactggacgcgcgatgcggcgatcgtgatggag
gaagtcagccatctcggctttaccggcacggaggccgatgcgttcgattttcggagcgcg
ttcgacgactatgtcgccttcagcctcgggacgacccgaattgacggcaatgccttcgtt
cccaatccgatccgtccctcgacacgcgaggattgcctgaaattcgtccgtcccgacgag
gaactggctcgcctcgatgcgttcaatctgccgggcgagccgcgcttcaatccggacggc
acacccgatctgcaacgctgggcccggccgcaatacgatggccctgcccttcgcgccctg
acgctggcgcgtcatgcgggattgttgctggagcggggcgagccgatcgcgaccgatctc
ctcgccattctgcagggcgacctcgagttcacgatccgccatgccggcaagccgtgcatc
gggccgtgggaagaggacaatgagcacacgctgcacagtttcacgctgatctgccagatc
ggtgccttggaacacgggcggaagctgctcgatcttctcggcgatgcgtttgccatggcc
ggccttcaggaggcgatcgacgaagcacaggctgctctgacctcgctctggaacgacgaa
ctcagcatccagatggcgcatggggcgatggatcccgcaacgccagcggaggctgtcgac
acgaatatcctgatggccgcgctgcatgccgatctgccggacggcgactggagtctttcg
gacgcccgcgtggaacggatcgtcgaggtgctgacggagatgttttcgaacctctacccg
atcaatgcgacattgccggatggcgagggaccgctgattgggcgcagtcttcatgaccgc
tatttcggcggcaatccctggtttgcgacgtcgctggcgctggccgaatatcactatcgc
cgagcctccggcgcagaacggacggaacgtctcagtcagggcgatgctatcgtcgcggcc
tgccgccgcttcatccccgaagacggggcgatgtcggaacaaatcgaccgggcgaccggc
gagccgctttcggcacggcatctgacgtggagctatgcggcatttctggccgccgccagc
gctcggcgcgaggcgcttgcctcagactga

DBGET integrated database retrieval system