KEGG   Hartmannibacter diazotrophicus: HDIA_3613Help
Entry
HDIA_3613         CDS       T05217                                 

Gene name
gstB_1
Definition
(GenBank) Glutathione S-transferase GST-6.0
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hdi  Hartmannibacter diazotrophicus
Pathway
hdi00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:hdi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    HDIA_3613 (gstB_1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hdi02000]
    HDIA_3613 (gstB_1)
Enzymes [BR:hdi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     HDIA_3613 (gstB_1)
Transporters [BR:hdi02000]
 Other Transporters
  Pores ion channels [TC:1]
   HDIA_3613 (gstB_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: SON57154
UniProt: A0A2C9DA03
LinkDB All DBs
Position
1:complement(3902053..3902652)
Genome map
AA seq 199 aa AA seqDB search
MKLYWCPQSRSATALWLMEEAGLPYERELIDIRKGDQSTDAFRAINPMMKVPALVDGEAQ
VAEVAAICLYVADIAAGAGLAPALGDPLRGRYLQYVVFGAAGIEAAITQLYAKFDMPTVS
AGWGSAERVCDVLDGELQKGDWILGERFSAADIVVGSGLHFAVKAFKMVPSRPSFDAYIA
RCEARPAWQRARAIEAAGG
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctactggtgtccgcaaagccgatccgcaaccgcgctctggctgatggaggag
gcgggccttccctacgagcgagagctcatcgacatccgcaagggcgatcagtcgacggac
gcctttcgggcgatcaacccgatgatgaaggtgccggcgcttgtcgatggcgaggcgcag
gtggcggaagtcgcagcgatctgcctctatgtcgcggacatcgccgccggagcgggactt
gcccccgcgctcggcgacccgttgcgcgggcgctacctgcaatatgtcgtcttcggggcg
gccggcattgaggcggcaatcacccagctttacgccaagttcgacatgccgacggtgtcg
gccgggtggggcagcgccgagcgtgtctgcgacgtgctcgacggcgaattgcaaaagggc
gactggatccttggcgagcgcttttccgccgccgacatcgtcgtcggctccgggctccac
tttgccgtgaaggccttcaagatggtgccctcgcgtccctccttcgacgcctatatcgcg
cgctgcgaggcgcgccccgcctggcagagggcacgggcgatcgaggcggcgggcggctga

DBGET integrated database retrieval system