KEGG   Hartmannibacter diazotrophicus: HDIA_3822Help
Entry
HDIA_3822         CDS       T05217                                 

Gene name
glpD
Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hdi  Hartmannibacter diazotrophicus
Pathway
hdi00564  Glycerophospholipid metabolism
hdi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hdi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    HDIA_3822 (glpD)
Enzymes [BR:hdi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     HDIA_3822 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_oxidored Pyr_redox_2 NAD_binding_8 FAD_binding_2 STPPase_N GIDA K_oxygenase
Motif
Other DBs
NCBI-ProteinID: SON57363
UniProt: A0A2C9DAU4
LinkDB All DBs
Position
1:4121935..4123452
Genome map
AA seq 505 aa AA seqDB search
MVYDIFVIGGGINGCGIARDAAGRGYSVCLAETKDFASGTSSGSTKLIHGGLRYLEHYEF
RLVREALMEREVLWRQAPHIIWPLRFVLPHHKGLRPAWFLRLGLFLYDHIGGRKLLPATR
TLDLTTDRAGKPLKTLFSKAFEYSDCWVNDARFVVLNARDAADRGAHIMARHTVVSARRD
GGKWSITLRDETSGAIETVAARLIVNAAGPWVDKVLSSAIGQNDAHNVRLVQGSHIVVKK
LYDHDRSYIFQNADGRIIFAIPYETDFTLIGTTDRDYEGDLRDVAITEGEIDYLCAAASE
YFVKPIVRDDVVWTYSGVRPLYDDGASKAQEATRDYVLKVDGSDGAPLVNIFGGKITTYR
RLAEAMLDKIAGLIGAKGAPWTASSTLPGGDFATDGYETLVARLRGDHPFLAERHARRLA
RLYGTRAFAILQSTASVADLGTHFGADLYEREVVFLMTHEWAASAEDVLWRRTKLGLSMS
GAEAEALDNWMKANAASYVTARAAE
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
ttggtctacgacatcttcgtcataggcggaggcatcaatggctgcggcatcgcaagggat
gccgccggccgcggatattccgtttgcctcgccgagacgaaggatttcgccagcggcacc
tcctccggctcgaccaagctcattcacggcggcctgcgttatctggagcattacgagttc
cggcttgtgcgcgaagcgctgatggagcgcgaggtgctctggcgccaggccccgcatatc
atctggccgctgcgctttgtgctgccacaccacaagggcctgcgcccggcctggttcctg
cgcctcggccttttcctctacgaccatatcggcggccgcaagctgctgccggcgacccgg
acgctggatctcaccacggatcgggccggcaagccgctgaagacgctcttctccaaggcg
ttcgaatattccgactgctgggtgaacgatgcccgcttcgttgtgctgaacgcgcgtgac
gcggccgatcgcggcgctcacatcatggcccgccacacggtggtgtctgcccgtcgcgat
ggcggcaaatggtccatcacgctgcgcgacgagacgtcgggcgccatcgagacggtcgcg
gcgcgcctcatcgtcaacgcggccggcccctgggtcgacaaggtgctctcctcggccatc
ggccagaacgacgcgcacaatgtccgcctcgtgcagggcagccacatcgtcgtgaagaag
ctctacgaccacgaccgcagctacatcttccagaatgccgacgggcgcatcatcttcgcg
atcccctacgagaccgacttcacgctgatcggcaccaccgaccgcgactatgagggcgac
ctgcgcgacgttgcgatcaccgaaggcgaaatcgactacctctgcgcggccgccagcgaa
tatttcgtcaagccgatcgtgcgcgacgatgtggtctggacctattccggcgtccgcccg
ctttacgacgacggcgccagcaaggcacaggaagcgacccgcgactatgtgctgaaggtc
gacggtagcgacggcgcccccctcgtcaacatcttcggcggcaagatcaccacttatcgc
cgcctcgccgaggcgatgctggacaagatcgccggcctcatcggcgccaagggcgcaccg
tggacggcttcttccaccctgccgggcggcgatttcgccaccgatggctacgagacgctt
gtcgcccgccttcgcggcgaccacccctttctggccgagcgccatgcccgccgcctggcc
cgcctctatggcacccgcgcctttgccatcctgcagtccacggcctcggttgccgatctc
ggcacccatttcggcgccgatctctacgagcgcgaggtcgtcttcctgatgacgcatgaa
tgggcggcaagcgccgaggacgtgctctggcggcgcaccaagctcgggctttcgatgtcc
ggggccgaggccgaggcgctggacaactggatgaaggcaaacgcggcaagctacgtgacc
gcgcgcgccgcggaatag

DBGET integrated database retrieval system