KEGG   Hartmannibacter diazotrophicus: HDIA_3859Help
Entry
HDIA_3859         CDS       T05217                                 

Gene name
cbbL
Definition
(GenBank) Ribulose bisphosphate carboxylase large chain
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
hdi  Hartmannibacter diazotrophicus
Pathway
hdi00630  Glyoxylate and dicarboxylate metabolism
hdi01100  Metabolic pathways
hdi01120  Microbial metabolism in diverse environments
hdi01200  Carbon metabolism
Module
hdi_M00165  Reductive pentose phosphate cycle (Calvin cycle)
hdi_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:hdi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    HDIA_3859 (cbbL)
Enzymes [BR:hdi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     HDIA_3859 (cbbL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: SON57400
UniProt: A0A2C9DB52
LinkDB All DBs
Position
1:complement(4168011..4169480)
Genome map
AA seq 489 aa AA seqDB search
MNDMSNPQEIRDQKKRYAAGVLKYAQMGYWDGDYEPKDTDLLALFRITPQDGVDPIEAAA
AVAGESSTATWTVVWTDRLTACDTYRAKAYRVEPVPNNPGQYFAYIAYDLVLFEEGSIAN
LTASIIGNVFSFKPLKAARLEDMRLPVAYCKTFKGPPTGLVVERERLDKFGRPLLGATTK
PKLGLSGKNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRFLYCMEAVNKASADTGEV
KGHYLNITAGTMEEMYRRAELAKELGSVVVMVDLIIGWTAIQSISEWCRQNDMILHMHRA
GHGTYTRQKNHGISFRVIAKWLRLAGVDHLHTGTAVGKLEGDPLTVQGYYNVCRESVNAV
DLPRGIFFEQDWADIKKVMPVASGGIHAGQMHQLLDLFGDDVVLQFGGGTIGHPMGIQAG
ATANRVALEAMVLARNEGRDIKIEGPEILREAAKWCKPLEAALDTWGNITFNYASTDTSD
FVPTATPAM
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacatgagcaatccgcaggaaatccgggaccagaagaagcgctatgccgccggt
gtcctgaaatatgcgcagatgggctactgggacggtgactacgaacccaaggacaccgat
ctgctggcgctcttccgcatcacgccgcaggacggtgtcgaccccattgaggccgccgcc
gctgtcgccggcgaaagttcgaccgccacctggaccgtggtctggaccgaccgcttgacg
gcctgcgacacctatcgcgccaaggcctaccgggtggagccggtgccgaacaatccgggc
cagtatttcgcctacatcgcctacgacctggtgcttttcgaggaaggctcgatcgccaac
ctcaccgcctcgatcatcggcaacgtcttctcgttcaagcccctgaaggcggcgcgcctt
gaggacatgcgcctgccggtcgcctactgcaagaccttcaaggggccgccgaccggcctc
gtcgtggagcgcgagcggctcgacaagttcggccggccgctgctcggtgcgacgaccaag
ccgaagctcggcctgtccggcaagaactacggccgcgtcgtctacgagggtctcaagggc
ggcctcgacttcatgaaggacgacgagaacatcaactcgcagcccttcatgcactggcgc
gaccgcttcctctactgcatggaggccgtcaacaaggcctcggccgataccggcgaggtc
aaggggcactacctcaacatcaccgccggcacgatggaggagatgtaccgccgcgcggag
cttgccaaggaactcggcagcgtcgtcgtcatggtcgacctcatcatcggctggaccgcg
atccagtcgatcagcgagtggtgccggcagaacgacatgatcctgcacatgcaccgcgcc
ggccacggcacctacacccgccagaagaaccacggcatcagcttccgcgtcatcgccaag
tggctgcgccttgccggcgtcgaccacctccacacgggcaccgctgtcggcaagctcgaa
ggcgatccgctcaccgtgcagggctactacaacgtctgccgcgagagtgtgaacgcggtc
gacctgccccggggtatcttcttcgagcaggactgggccgacatcaagaaggtgatgccg
gtcgcctctggcggtatccatgccggccagatgcaccagctcctcgatctcttcggcgac
gacgtggtgctgcagttcggcggcggcacgatcggccatccgatgggcatccaggcggga
gcgacggcgaatcgcgtcgcgctcgaggcgatggtccttgcccgcaatgagggccgggac
atcaagatcgagggcccggagattcttcgcgaggccgccaagtggtgcaagcccctggaa
gcggccctcgatacctggggcaacatcaccttcaactatgcctcgaccgacacgtcggac
ttcgtgccgacggcaacgcccgccatgtga

DBGET integrated database retrieval system