KEGG   Hartmannibacter diazotrophicus: HDIA_4866Help
Entry
HDIA_4866         CDS       T05217                                 

Gene name
echA8_3
Definition
(GenBank) putative enoyl-CoA hydratase echA8
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
hdi  Hartmannibacter diazotrophicus
Pathway
hdi00071  Fatty acid degradation
hdi00280  Valine, leucine and isoleucine degradation
hdi00281  Geraniol degradation
hdi00310  Lysine degradation
hdi00360  Phenylalanine metabolism
hdi00362  Benzoate degradation
hdi00380  Tryptophan metabolism
hdi00410  beta-Alanine metabolism
hdi00627  Aminobenzoate degradation
hdi00640  Propanoate metabolism
hdi00650  Butanoate metabolism
hdi00903  Limonene and pinene degradation
hdi00930  Caprolactam degradation
hdi01100  Metabolic pathways
hdi01110  Biosynthesis of secondary metabolites
hdi01120  Microbial metabolism in diverse environments
hdi01130  Biosynthesis of antibiotics
hdi01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:hdi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    HDIA_4866 (echA8_3)
   00650 Butanoate metabolism
    HDIA_4866 (echA8_3)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HDIA_4866 (echA8_3)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HDIA_4866 (echA8_3)
   00310 Lysine degradation
    HDIA_4866 (echA8_3)
   00360 Phenylalanine metabolism
    HDIA_4866 (echA8_3)
   00380 Tryptophan metabolism
    HDIA_4866 (echA8_3)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HDIA_4866 (echA8_3)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    HDIA_4866 (echA8_3)
   00281 Geraniol degradation
    HDIA_4866 (echA8_3)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HDIA_4866 (echA8_3)
   00627 Aminobenzoate degradation
    HDIA_4866 (echA8_3)
   00930 Caprolactam degradation
    HDIA_4866 (echA8_3)
Enzymes [BR:hdi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     HDIA_4866 (echA8_3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: SON58407
UniProt: A0A2C9DDM9
LinkDB All DBs
Position
1:5324794..5325567
Genome map
AA seq 257 aa AA seqDB search
MAFETILTETRGHVALIRLNRPKALNALSDQLLTELGTALDHFEADDAIGCIVLTGSEKA
FAAGADIKEMASLDFLTAYKNDFAHKIDRVAACRKPVIAAVAGYALGGGCELAMSCDFIL
AADTAKFGQPEITLGIMPGMGGTQRLTRLIGRSKAMEMCLTGRMMEAAEAERAGLVSRIL
PADDLIDEALKTAEKIADFSLPAVMMAKESINRAEEIALAEGLRFERRLFNAMFGTEDQK
EGMAAFMEKRGAQFSGR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggccttcgaaaccatcctgaccgagacacgcggccatgtcgctctcatccgcctcaac
cggccaaaggcgcttaacgcgctctctgaccagctcctgaccgaactcggcaccgcgctc
gatcatttcgaggcggacgatgcgatcggctgcatcgtcctgaccggcagcgaaaaggcc
ttcgcggccggcgccgacatcaaggagatggcgagcctcgatttcctcaccgcctacaag
aatgacttcgcccacaagatcgatcgcgtcgcggcttgccgcaagccggtgatcgccgcg
gtcgccggttatgcgctcggtggcggctgcgagcttgccatgtcctgcgacttcattctg
gccgccgacacggccaagttcggtcagcccgagatcaccctcggcatcatgcccggcatg
ggcggcacccagcgcctgacgcgtctcatcggtcgctccaaggcgatggagatgtgcctc
acgggacggatgatggaggccgcggaggccgagcgggcaggcctcgtcagccgcatcctg
ccggccgacgatctcatcgacgaggcgctgaagacggcggagaaaatcgccgatttctcg
ctgcccgccgtcatgatggccaaggaatcgatcaaccgcgccgaggagatcgcgctggcc
gaaggccttcgcttcgagcggcgcctcttcaacgcgatgttcgggaccgaggaccagaag
gaaggcatggcggccttcatggagaagcgcggcgcccagttttccgggcgctga

DBGET integrated database retrieval system