KEGG   Hartmannibacter diazotrophicus: HDIA_P0093Help
Entry
HDIA_P0093        CDS       T05217                                 

Gene name
idnD_2
Definition
(GenBank) L-idonate 5-dehydrogenase
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
hdi  Hartmannibacter diazotrophicus
Brite
KEGG Orthology (KO) [BR:hdi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HDIA_P0093 (idnD_2)
Enzymes [BR:hdi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     HDIA_P0093 (idnD_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Methyltransf_25 Methyltransf_11 Gp_dh_N TPMT ThiF
Motif
Other DBs
NCBI-ProteinID: SON58502
UniProt: A0A2C9DDU5
LinkDB All DBs
Position
HDIAp1:100889..101941
Genome map
AA seq 350 aa AA seqDB search
MEFAAMRAIVAHQPHDLRIEEWPDAAAPGPGEVRVRVARGGICGSDLHYYHHAGFGTVRL
KEPMILGHEVAGRVMDVGVGVSDFAADDPVAINPGMPCNDCHFCRKGQRNQCLDMSFFGS
AMRFPHMQGLFRDEVTVPAEQLYKVPQCLDLGLAACAEPFAVCLHAVASAGSLLGAKVLV
SGCGPIGNLVLAAARHAGAREIVAVDIADAALTVAGKLGADSTINLTKTPDGLAPFADRK
GLFDAVFECSGAPKALAAALDVVRPGGALVTVGLGGDISLPLNLVVTKEILMRGSFRFDA
EFGLAVHLIATGAVDLTPLISATMPAADADAAFRLASDRSQSMKVQLAFA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggagttcgccgccatgcgcgcgatagttgcccaccagccccatgacctgcgcatcgag
gagtggcccgacgccgccgctcccggacccggcgaagtccgggtccgtgtcgcgcgtggc
ggcatctgcggatcggaccttcactattatcaccacgccggcttcggcacggtccggctg
aaggaaccgatgatcctcggccacgaggtggcgggccgcgtcatggacgttggggtgggc
gtttcggactttgccgccgacgatcccgtcgcgatcaatcccggcatgccctgcaacgac
tgccacttctgccgcaagggtcagcgcaaccagtgtcttgacatgagcttcttcggcagc
gccatgcgctttccgcacatgcaggggctcttccgcgacgaggtgaccgttccggcggag
cagctttacaaggtgccgcaatgcctcgacctcggtcttgcagcctgcgccgaacctttc
gcggtctgcctgcatgcggttgcgagcgccggaagcttgcttggcgcaaaagtgctcgtt
tcgggctgcgggccgattggaaatctcgtcctcgcggcggcgcgccacgccggcgctcgg
gaaattgtcgcggtcgacatcgccgatgcggcgcttactgttgccggaaagcttggcgcc
gactcgacgatcaacctcaccaaaactccggatggactcgcccccttcgcggaccgcaag
gggctcttcgacgcggtcttcgaatgttccggcgcgccgaaggcgcttgcggctgcgctg
gacgttgtgcgtccgggcggagcgctcgtgacagttggtcttggcggcgacatctccttg
cccttgaatctcgttgtgacgaaggaaatcctgatgcgcggcagtttccgttttgatgcg
gaatttggcctcgcggttcatctgatcgccacgggggccgttgatctcacgccactcatt
tcggcgacgatgccggcggccgacgccgacgcggcctttcgccttgcatccgatcgcagc
cagtcgatgaaagtccaactggccttcgcctga

DBGET integrated database retrieval system